catalog number :
MBS969663
products type :
Recombinant Protein
products full name :
Recombinant Staphylococcus aureus Enterotoxin type B (entB)
products short name :
[Enterotoxin type B]
products name syn :
[SEB]
other names :
[enterotoxin; Enterotoxin type B; SEB]
products gene name :
[entB]
other gene names :
[entB]
uniprot entry name :
ETXB_STAAU
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[28-266. Full Length of Mature Protein]
sequence :
ESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVK
SIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYK
DKYVDVFGANYYYQCYFSKKTNDINSHQTDKRKTCMYGG
VTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVT
AQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENS
FWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYL
TTKKK
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
image1 heading :
SDS-Page
other info2 :
Production Note: Special Offer: The E Coli, Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Coli, Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli, Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli, Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
products description :
Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness characterized by high fever, hypotension, diarrhea, shock, and in some cases death.
products references :
Nucleotide sequence of the enterotoxin B gene from Staphylococcus aureus.Jones C.L., Khan S.A.J. Bacteriol. 166:29-33(1986)
Molecular cloning of staphylococcal enterotoxin B gene in Escherichia coli and Staphylococcus aureus.Ranelli D.M., Jones C.L., Johns M.B., Mussey G.J., Khan S.A.Proc. Natl. Acad. Sci. U.S.A. 82:5850-5854(1985)
The primary structure of staphylococcal enterotoxin B. 3. The cyanogen bromide peptides of reduced and aminoethylated enterotoxin B, and the complete amino acid sequence.Huang I.-Y., Bergdoll M.S.J. Biol. Chem. 245:3518-3525(1970)
Crystal structure of staphylococcal enterotoxin B, a superantigen.Swaminathan S., Furey W.F. Jr., Pletcher J., Sax M.Nature 359:801-806(1992)
Three-dimensional structure of a human class II histocompatibility molecule complexed with superantigen.Jardetzky T.S., Brown J.H., Gorga J.C., Stern L.J., Urban R.G., Chi Y.I., Stauffacher C., Strominger J.L., Wiley D.C.Nature 368:711-718(1994)
Three-dimensional structure of the complex between a T cell receptor beta chain and the superantigen staphylococcal enterotoxin B.Li H., Llera A., Tsuchiya D., Leder L., Ysern X., Schlievert P.M., Karjalainen K., Mariuzza R.A.Immunity 9:807-816(1998)
Crystal structure of microbial superantigen staphylococcal enterotoxin B at 1.5-A resolution
implications for superantigen recognition by MHC class II molecules and T-cell receptors.Papageorgiou A.C., Tranter H.S., Acharya K.R.J. Mol. Biol. 277:61-79(1998)
ncbi acc num :
WP_000278085.1
ncbi gb acc num :
WP_000278085.1
uniprot summary :
Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness characterized by high fever, hypotension, diarrhea, shock, and in some cases death.
size9 :
0.05 mg (Baculovirus)
size11 :
0.05 mg (Mammalian-Cell)
size13 :
0.1 mg (Baculovirus)
size15 :
0.5 mg (Baculovirus)
size16 :
0.1 mg (Mammalian-Cell)
size18 :
1 mg (Baculovirus)