protein

Recombinant Human Atypical chemokine receptor 3

MBS968533

0.01 mg (E-Coli)

110 USD

Recombinant Protein

Recombinant Human Atypical chemokine receptor 3

Atypical chemokine receptor 3

C-X-C chemokine receptor type 7; CXC-R7; CXCR-7; Chemokine orphan receptor 1; G-protein coupled receptor 159; G-protein coupled receptor RDC1 homolog; RDC-1

atypical chemokine receptor 3; Atypical chemokine receptor 3; atypical chemokine receptor 3; atypical chemokine receptor 3; C-X-C chemokine receptor type 7; CXC-R7; CXCR-7; Chemokine orphan receptor 1; G-protein coupled receptor 159; G-protein coupled receptor RDC1 homolog; RDC-1

ACKR3

ACKR3; ACKR3; RDC1; CXCR7; RDC-1; CMKOR1; CXC-R7; CXCR-7; GPR159; CMKOR1; CXCR7; GPR159; RDC1; CXC-R7; CXCR-7; RDC-1

ACKR3_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

Jan-40

40

MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPN
K

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Species: Homo sapiens (Human)

Signal Transduction

Atypical chemokine receptor that controls chemokine levels and localization via high-affinity chemokine binding that is uncoupled from classic ligand-driven signal transduction cascades, resulting instead in chemokine sequestration, degradation, or transcytosis. Also known as interceptor (internalizing receptor) or chemokine-scavenging receptor or chemokine decoy receptor. Acts as a receptor for chemokines CXCL11 and CXCL12/SDF1. Chemokine binding does not activate G-protein-mediated signal transduction but instead induces beta-arrestin recruitment, leading to ligand internalization and activation of MAPK signaling pathway. Required for regulation of CXCR4 protein levels in migrating interneurons, thereby adapting their chemokine responsiveness. In glioma cells, transduces signals via MEK/ERK pathway, mediating resistance to apoptosis. Promotes cell growth and survival. Not involved in cell migration, adhesion or proliferation of normal hematopoietic progenitors but activated by CXCL11 in malignant hemapoietic cells, leading to phosphorylation of ERK1/2 (MAPK3/MAPK1) and enhanced cell adhesion and migration. Plays a regulatory role in CXCR4-mediated activation of cell surface integrins by CXCL12. Required for heart valve development. Acts as coreceptor with CXCR4 for a restricted number of HIV isolates.

Cloning and expression of the human vasoactive intestinal peptide receptor." Sreedharan S.P., Robichon A., Peterson K.E., Goetzl E.J. Proc. Natl. Acad. Sci. U.S.A. 88:4986-4990(1991)

31083344

NP_064707.1

NM_020311.2

P25106

20.52kD

Chemokine Receptors Bind Chemokines Pathway (1269547); Class A/1 (Rhodopsin-like Receptors) Pathway (1269545); Cytokine-cytokine Receptor Interaction Pathway (83051); Cytokine-cytokine Receptor Interaction Pathway (460); G Alpha (i) Signalling Events Pathway (1269576); GPCR Downstream Signaling Pathway (1269574); GPCR Ligand Binding Pathway (1269544); GPCRs, Class A Rhodopsin-like Pathway (198886); Myometrial Relaxation And Contraction Pathways (198759); Peptide Ligand-binding Receptors Pathway (1269546)

This gene encodes a member of the G-protein coupled receptor family. Although this protein was earlier thought to be a receptor for vasoactive intestinal peptide (VIP), it is now considered to be an orphan receptor, in that its endogenous ligand has not been identified. The protein is also a coreceptor for human immunodeficiency viruses (HIV). Translocations involving this gene and HMGA2 on chromosome 12 have been observed in lipomas. [provided by RefSeq, Jul 2008]

CMKOR1: Receptor for chemokines CXCL12/SDF1 and CXCL11. Does not elicit classical chemokine receptor signaling; chemokine binding does not activate G-protein-mediated signal transduction but instead induces beta-arrestin recruitment, leading to ligand internalization and activation of MAPK signaling pathway. Acts as a scavenger for CXCL12/SDF1 and, to a lesser extent, for CXCL11. Required for regulation of CXCR4 protein levels in migrating interneurons, thereby adapting their chemokine responsiveness. In glioma cells, transduces signals via MEK/ERK pathway, mediating resistance to apoptosis. Promotes cell growth and survival. Not involved in cell migration, adhesion or proliferation of normal hematopoietic progenitors but activated by CXCL11 in malignant hemapoietic cells, leading to phosphorylation of ERK1/2 (MAPK3/MAPK1) and enhanced cell adhesion and migration. Plays a regulatory role in CXCR4-mediated activation of cell surface integrins by CXCL12. Required for heart valve development. Acts as coreceptor with CXCR4 for a restricted number of HIV isolates. Belongs to the G-protein coupled receptor 1 family. Protein type: Receptor, GPCR; Membrane protein, multi-pass; Membrane protein, integral; GPCR, family 1. Chromosomal Location of Human Ortholog: 2q37.3. Cellular Component: cell surface; coated pit; early endosome; endosome; integral to membrane; intracellular membrane-bound organelle; perinuclear region of cytoplasm; plasma membrane; recycling endosome. Molecular Function: C-X-C chemokine binding; C-X-C chemokine receptor activity; coreceptor activity; protein binding; scavenger receptor activity. Biological Process: angiogenesis; cell adhesion; chemotaxis; G-protein coupled receptor protein signaling pathway; positive regulation of defense response to virus by host; receptor internalization; vasculogenesis; viral reproduction

0.01 mg (E-Coli)

110 USD

0.05 mg (E-Coli)

190

0.2 mg (E-Coli)

460

0.5 mg (E-Coli)

715

0.5 mg (Yeast)

1055