product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Interferon alpha/beta receptor 1
catalog :
MBS968510
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
product information
catalog number :
MBS968510
products type :
Recombinant Protein
products full name :
Recombinant Human Interferon alpha/beta receptor 1
products short name :
Interferon alpha/beta receptor 1
products name syn :
Cytokine receptor class-II member 1; Cytokine receptor family 2 member 1; CRF2-1; Type I interferon receptor 1
other names :
interferon alpha/beta receptor 1; Interferon alpha/beta receptor 1; interferon alpha/beta receptor 1; interferon alpha and beta receptor subunit 1; Cytokine receptor class-II member 1; Cytokine receptor family 2 member 1; CRF2-1; Type I interferon receptor 1
products gene name :
IFNAR1
other gene names :
IFNAR1; IFNAR1; AVP; IFRC; IFNAR; IFNBR; IFN-alpha-REC; IFNAR; IFN-R-1; IFN-alpha/beta receptor 1; CRF2-1
uniprot entry name :
INAR1_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
48-436
sequence length :
557
sequence :
KNLKSPQKVEVDIIDDNFILRWNRSDESVGNVTFSFDYQ
KTGMDNWIKLSGCQNITSTKCNFSSLKLNVYEEIKLRIR
AEKENTSSWYEVDSFTPFRKAQIGPPEVHLEAEDKAIVI
HISPGTKDSVMWALDGLSFTYSLVIWKNSSGVEERIENI
YSRHKIYKLSPETTYCLKVKAALLTSWKIGVYSPVHCIK
TTVENELPPPENIEVSVQNQNYVLKWDYTYANMTFQVQW
LHAFLKRNPGNHLYKWKQIPD
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Epigenetics and Nuclear Signaling
products description :
Associates with IFNAR2 to form the type I interferon receptor. Receptor for interferons alpha and beta. Binding to type I IFNs triggers tyrosine phosphorylation of a number of proteins including JAKs, TYK2, STAT proteins and IFNR alpha- and beta-subunits thselves. Can also transduce IFNB signals without the help of IFNAR2, and not activating the Jak-STAT pathway.
products references :
Genetic transfer of a functional human interferon alpha receptor into mouse cells cloning and expression of its cDNA.Uze G., Lutfalla G., Gresser I.Cell 60:225-234(1990) The structure of the human interferon alpha/beta receptor gene.Lutfalla G., Gardiner K., Proudhon D., Vielh E., Uze G.J. Biol. Chem. 267:2802-2809(1992) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. SeattleSNPs variation discovery resourceThe DNA sequence of human chromosome 21.Hattori M., Fujiyama A., Taylor T.D., Watanabe H., Yada T., Park H.-S., Toyoda A., Ishii K., Totoki Y., Choi D.-K., Groner Y., Soeda E., Ohki M., Takagi T., Sakaki Y., Taudien S., Blechschmidt K., Polley A., Menzel U., Delabar J., Kumpf K., Lehmann R., Patterson D., Reichwald K., Rump A., Schillhabel M., Schudy A., Zimmermann W., Rosenthal A., Kudoh J., Shibuya K., Kawasaki K., Asakawa S., Shintani A., Sasaki T., Nagamine K., Mitsuyama S., Antonarakis S.E., Minoshima S., Shimizu N., Nordsiek G., Hornischer K., Brandt P., Scharfe M., Schoen O., Desario A., Reichelt J., Kauer G., Bloecker H., Ramser J., Beck A., Klages S., Hennig S., Riesselmann L., Dagand E., Wehrmeyer S., Borzym K., Gardiner K., Nizetic D., Francis F., Lehrach H., Reinhardt R., Yaspo M.-L.Nature 405:311-319(2000)
ncbi gi num :
46488932
ncbi acc num :
NP_000620.2
ncbi gb acc num :
NM_000629.2
uniprot acc num :
P17181
ncbi mol weight :
74.2kD
ncbi pathways :
Cytokine Signaling In Immune System Pathway (1269310); Cytokine-cytokine Receptor Interaction Pathway (83051); Cytokine-cytokine Receptor Interaction Pathway (460); Downstream Signaling In Naive CD8+ T Cells Pathway (138018); Hepatitis B Pathway (694606); Hepatitis C Pathway (173973); Hepatitis C Pathway (173907); Herpes Simplex Infection Pathway (377873); Herpes Simplex Infection Pathway (377865); Immune System Pathway (1269170)
ncbi summary :
The protein encoded by this gene is a type I membrane protein that forms one of the two chains of a receptor for interferons alpha and beta. Binding and activation of the receptor stimulates Janus protein kinases, which in turn phosphorylate several proteins, including STAT1 and STAT2. The encoded protein also functions as an antiviral factor. [provided by RefSeq, Jul 2008]
uniprot summary :
IFNAR1: receptor for interferons alpha and beta. Belongs to the type II cytokine family of receptors. Binding to type I IFNs triggers tyrosine phosphorylation of a number of proteins including JAKs, TYK2, STAT proteins and IFNR alpha- and beta-subunits themselves. Tyk2 tyrosine kinase is essential for stable cell surface expression of IFNAR1. Present in all tissues and even on the surface of most IFN-resistant cells. Protein type: Membrane protein, integral; Receptor, cytokine. Chromosomal Location of Human Ortholog: 21q22.11. Cellular Component: integral to plasma membrane; intracellular; plasma membrane. Molecular Function: interferon-alpha/beta binding; interferon-alpha/beta receptor activity; protein binding. Biological Process: cytokine and chemokine mediated signaling pathway; defense response to virus; interferon type I biosynthetic process; JAK-STAT cascade; positive regulation of interferon-beta production; positive regulation of interferon-gamma production; positive regulation of interleukin-1 beta secretion; positive regulation of transcription, DNA-dependent; regulation of peptidyl-tyrosine phosphorylation; response to lipopolysaccharide; response to virus; T cell activation
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
1 mg (E-Coli)
price4 :
1180
size5 :
0.05 mg (Baculovirus)
price5 :
1180
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!