catalog number :
MBS968456
products type :
Recombinant Protein
products full name :
Recombinant Human T-cell surface glycoprotein CD8 alpha chain
products short name :
T-cell surface glycoprotein CD8 alpha chain
products name syn :
T-lymphocyte differentiation antigen T8/Leu-2; CD_antigen: CD8a
other names :
T-cell surface glycoprotein CD8 alpha chain isoform 1; T-cell surface glycoprotein CD8 alpha chain; T-cell surface glycoprotein CD8 alpha chain; CD8a molecule; T-lymphocyte differentiation antigen T8/Leu-2; CD_antigen: CD8a
products gene name :
CD8A
other gene names :
CD8A; CD8A; CD8; MAL; p32; Leu2; MAL
uniprot entry name :
CD8A_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
22-182; Provide the complete extracellular domain.
sequence :
SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQP
RGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFV
LTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPT
TTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGL
DFACD
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
other info2 :
Species: Homo sapiens (Human)
products categories :
Immunology
products description :
Identifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is thought to play a role in the process of T-cell mediated killing. CD8 alpha chains binds to class I MHC molecules alpha-3 domains.
products references :
The isolation and sequence of the gene encoding T8: a molecule defining functional classes of T lymphocytes."
Littman D.R., Thomas Y., Maddon P.J., Chess L., Axel R.
Cell 40:237-246(1985)
ncbi acc num :
NP_001139345.1
ncbi gb acc num :
NM_001145873.1
ncbi pathways :
Adaptive Immune System Pathway (1269171); Antigen Processing And Presentation Pathway (83074); Antigen Processing And Presentation Pathway (485); Cell Adhesion Molecules (CAMs) Pathway (83069); Cell Adhesion Molecules (CAMs) Pathway (480); Downstream Signaling In Naive CD8+ T Cells Pathway (138018); Hematopoietic Cell Lineage Pathway (83078); Hematopoietic Cell Lineage Pathway (489); IL12-mediated Signaling Events Pathway (137922); Immune System Pathway (1269170)
ncbi summary :
The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen acts as a coreceptor with the T-cell receptor on the T lymphocyte to recognize antigens displayed by an antigen presenting cell in the context of class I MHC molecules. The coreceptor functions as either a homodimer composed of two alpha chains or as a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. This gene encodes the CD8 alpha chain. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]