product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Signal transducer and activator of transcription 5B (STAT5B)
catalog :
MBS968437
quantity :
1 mg (E-Coli)
price :
1375 USD
more info or order :
product information
catalog number :
MBS968437
products type :
Recombinant Protein
products full name :
Recombinant Human Signal transducer and activator of transcription 5B (STAT5B)
products short name :
Signal transducer and activator of transcription 5B (STAT5B)
products name syn :
Recombinant Signal transducer and activator of transcription 5B (STAT5B); Signal transducer and activator of transcription 5B
other names :
signal transducer and activator of transcription 5B; Signal transducer and activator of transcription 5B; signal transducer and activator of transcription 5B; transcription factor STAT5B; signal transducer and activator of transcription 5B
products gene name syn :
STAT5B
other gene names :
STAT5B; STAT5B; STAT5
uniprot entry name :
STA5B_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-787
sequence length :
787
sequence :
MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIE
SQAWDSVDLDNPQENIKATQLLEGLVQELQKKAEHQVGE
DGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQ
RLVREANNGSSPAGSLADAMSQKHLQINQTFEELRLVTQ
DTENELKKLQQTQEYFIIQYQESLRIQAQFGPLAQLSPQ
ERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQ
KTLQLLRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLD
VLQSWCEKLAEIIWQNRQQIRRAEHLCQQLPIPGPVEEM
LAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAAT
VRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRN
DYSGEILNNCCVMEYHQATGTLSAHFRNMSLKRIKRSDR
RGAESVTEEKFTILFESQFSVGGNELVFQVKTLSLPVVV
IVHGSQDNNATATVLWDNAFAEPGRVPFAVPDKVLWPQL
CEALNMKFKAEVQSNRGLTKENLVFLAQKLFNNSSSHLE
DYSGLSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHL
KPHWNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDSEI
GGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRLGDL
NYLIYVFPDRPKDEVYSKYYTPVPCESATAKAVDGYVKP
QIKQVVPEFVNASADAGGGSATYMDQAPSPAVCPQAHYN
MYPQNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDSQ
WIPHAQS
purity :
>90%(SDS-PAGE)
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Species: Homo sapiens (Human)
products description :
Carries out a dual function: signal transduction and activation of transcription. Mediates cellular responses to the cytokine KITLG/SCF and other growth factors. Binds to the GAS element and activates PRL-induced transcription.
ncbi gi num :
21618344
ncbi acc num :
NP_036580.2
ncbi gb acc num :
NM_012448.3
uniprot acc num :
P51692
ncbi mol weight :
88kD
ncbi pathways :
Acute Myeloid Leukemia Pathway (83117); Acute Myeloid Leukemia Pathway (529); Adipogenesis Pathway (198832); Angiopoietin Receptor Tie2-mediated Signaling Pathway (137917); CXCR4-mediated Signaling Events Pathway (137910); Chemokine Signaling Pathway (99051); Chemokine Signaling Pathway (96864); Chronic Myeloid Leukemia Pathway (83116); Chronic Myeloid Leukemia Pathway (528); Cytokine Signaling In Immune System Pathway (366171)
ncbi summary :
The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein mediates the signal transduction triggered by various cell ligands, such as IL2, IL4, CSF1, and different growth hormones. It has been shown to be involved in diverse biological processes, such as TCR signaling, apoptosis, adult mammary gland development, and sexual dimorphism of liver gene expression. This gene was found to fuse to retinoic acid receptor-alpha (RARA) gene in a small subset of acute promyelocytic leukemias (APLL). The dysregulation of the signaling pathways mediated by this protein may be the cause of the APLL. [provided by RefSeq, Jul 2008]
uniprot summary :
STAT5B: transcription factor of the STAT family. Phosphorylated and activated by receptor-associated kinases triggered by cytokines including IL2, IL3, GM-CSF, and various growth hormones. It has been shown to be involved in diverse biological processes, such as TCR signaling, apoptosis, adult mammary gland development, and sexual dimorphism of liver gene expression. Forms homo- or heterodimers that translocate into the nucleus where they regulate transcription. Protein type: Oncoprotein; DNA-binding; Transcription factor. Chromosomal Location of Human Ortholog: 17q11.2. Cellular Component: nucleoplasm; cytoplasm; cytosol; nucleus. Molecular Function: protein dimerization activity; protein binding; signal transducer activity; double-stranded DNA binding; chromatin binding; transcription factor activity; protein phosphatase binding; glucocorticoid receptor binding. Biological Process: positive regulation of interleukin-2 biosynthetic process; T cell differentiation in the thymus; response to lipopolysaccharide; positive regulation of multicellular organism growth; female pregnancy; 2-oxoglutarate metabolic process; sequestering of lipid; allantoin metabolic process; natural killer cell differentiation; regulation of steroid metabolic process; acute-phase response; T cell homeostasis; Peyer s patch development; isoleucine metabolic process; positive regulation of natural killer cell proliferation; valine metabolic process; development of secondary female sexual characteristics; JAK-STAT cascade; regulation of transcription from RNA polymerase II promoter; response to ethanol; regulation of epithelial cell differentiation; positive regulation of transcription from RNA polymerase II promoter; taurine metabolic process; negative regulation of apoptosis; lactation; transcription from RNA polymerase II promoter; succinate metabolic process; oxaloacetate metabolic process; positive regulation of smooth muscle cell proliferation; progesterone metabolic process; positive regulation of mitotic cell cycle; fatty acid metabolic process; positive regulation of activated T cell proliferation; response to estradiol stimulus; positive regulation of natural killer cell differentiation; luteinization; development of secondary male sexual characteristics; creatinine metabolic process; positive regulation of gamma-delta T cell differentiation; negative regulation of erythrocyte differentiation; citrate metabolic process; regulation of multicellular organism growth; positive regulation of cell motility; positive regulation of natural killer cell mediated cytotoxicity; liver development; creatine metabolic process; cellular response to hormone stimulus; response to hypoxia; positive regulation of B cell differentiation; positive regulation of inflammatory response. Disease: Growth Hormone Insensitivity With Immunodeficiency
size1 :
1 mg (E-Coli)
price1 :
1375 USD
size2 :
1 mg (Yeast)
price2 :
1835
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!