protein

Recombinant Mouse Muellerian-inhibiting factor

MBS968365

0.05 mg (E-Coli)

180 USD

Recombinant Protein

Recombinant Mouse Muellerian-inhibiting factor

Muellerian-inhibiting factor

Anti-Muellerian hormone; AMH; Muellerian-inhibiting substance; MIS

Muellerian-inhibiting factor; Muellerian-inhibiting factor; muellerian-inhibiting factor; anti-Mullerian hormone; Anti-Muellerian hormone; AMH; Muellerian-inhibiting substance; MIS

Amh

Amh; Amh; MIS; AMH; MIS

MIS_MOUSE

E Coli or Yeast or Baculovirus or Mammalian Cell

450-552

555

DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACR
WPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYA
GKLLISLSEERISADHVPNMVATEC

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin.

Expression of the mouse anti-Mullerian hormone gene suggests a role in both male and female sexual differentiation.Muensterberg A., Lovell-Badge R.Development 113:613-624(1991) A GNRP-like gene shares a bidirectional promoter with SAP62 immediately upstream of AMH.Dresser D.W., Jamin S., Atkins C.J., Guerrier D. The genes for a spliceosome protein (SAP62) and the anti-Mullerian hormone (AMH) are contiguous.Dresser D.W., Hacker A., Lovell-Badge R., Guerrier D.Hum. Mol. Genet. 4:1613-1618(1995)

127110

P27106.1

P27106

13kD

BMP Signaling Pathway (1084868); BMP Signaling Pathway (1108218); Cytokine-cytokine Receptor Interaction Pathway (83248); Cytokine-cytokine Receptor Interaction Pathway (460); Hippo Signaling Pathway (749786); Hippo Signaling Pathway (750388); TGF-beta Signaling Pathway (83261); TGF-beta Signaling Pathway (475); CAMP Signaling Pathway (1017641); CAMP Signaling Pathway (1019520)

This gene is a member of the transforming growth factor-beta superfamily of growth and differentiation factors. The encoded protein is produced in fetal Sertoli cells during male gonadal differentiation. The protein binds to the anti-Mullerian hormone receptor type 2 and causes the regression of Mullerian ducts in developing male embryos. In humans, some mutations in this gene are associated with persistent Mullerian duct syndrome (PMDS). [provided by RefSeq, Apr 2013]

AMH: This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin. Defects in AMH are the cause of persistent Muellerian duct syndrome type 1 (PMDS1). PMDS1 is a form of male pseudohermaphroditism characterized by a failure of Muellerian duct regression in otherwise normal males. Belongs to the TGF-beta family. Protein type: Secreted, signal peptide; Secreted. Cellular Component: cytoplasm; extracellular space. Molecular Function: hormone activity; receptor binding; transforming growth factor beta receptor binding. Biological Process: activation of NF-kappaB transcription factor; cell-cell signaling; Mullerian duct regression; preantral ovarian follicle growth; urogenital system development

0.05 mg (E-Coli)

180 USD

0.05 mg (Yeast)

190

0.2 mg (Yeast)

460

0.2 mg (E-Coli)

490

0.5 mg (E-Coli)

715