catalog number :
MBS968326
products type :
Recombinant Protein
products full name :
Recombinant Human Annexin A2 (ANXA2)
products short name :
[Annexin A2 (ANXA2)]
products name syn :
[Annexin II; Annexin-2; Calpactin I heavy chain; Calpactin-1 heavy chain; Chromobindin-8; Lipocortin II; Placental anticoagulant protein IV; PAP-IV; Protein I; p36]
other names :
[annexin A2 isoform 2; Annexin A2; Annexin II; Annexin-2; Calpactin I heavy chain; Calpactin-1 heavy chain; Chromobindin-8; Lipocortin II; Placental anticoagulant protein IV; PAP-IV; Protein I; p36]
products gene name :
[ANXA2]
other gene names :
[ANXA2; ANX2; ANX2L4; CAL1H; LPC2D; PAP-IV]
uniprot entry name :
ANXA2_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[2-339. Full Length of Mature Protein]
sequence :
STVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDAL
NIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRT
KKELASALKSALSGHLETVILGLLKTPAQYDASELKASM
KGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEK
DIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDAR
DLYDAGVKRKGTDVPKWISIMTERSVPHLQKVFDRYKSY
SPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFADRL
YDSMKGKGTRDKVLIRIMVSRSEVDMLKIRSEFKRKYGK
SLYYYIQQDTKGDYQKALLYLCGGDD
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
image1 heading :
SDS-PAGE
other info2 :
Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
products categories :
Signal Transduction
products description :
Calcium-regulated membrane-binding protein whose affinity for calcium is greatly enhanced by anionic phospholipids. It binds two calcium ions with high affinity. May be involved in heat-stress response.
products references :
Two human 35 kd inhibitors of phospholipase A2 are related to substrates of pp60v-src and of the epidermal growth factor receptor/kinase.Huang K.-S., Wallner B.P., Mattaliano R.J., Tizard R., Burne C., Frey A., Hession C., McGray P., Sinclair L.K., Chow E.P., Browning J.L., Ramachandran K.L., Tang J., Smart J.E., Pepinsky R.B.Cell 46:191-199(1986)
ncbi acc num :
NP_001002857.1
ncbi gb acc num :
NM_001002857.1
ncbi pathways :
Dissolution Of Fibrin Clot Pathway (1269372); Hemostasis Pathway (1269340); Muscle Contraction Pathway (1269868); Prostaglandin Synthesis And Regulation Pathway (198912); Smooth Muscle Contraction Pathway (1269870)
ncbi summary :
This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions as an autocrine factor which heightens osteoclast formation and bone resorption. This gene has three pseudogenes located on chromosomes 4, 9 and 10, respectively. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
uniprot summary :
ANXA2: a calcium-regulated membrane-binding protein whose affinity for calcium is greatly enhanced by anionic phospholipids. It binds two calcium ions with high affinity. Heterotetramer containing 2 light chains of S100A10 2 heavy chains of ANXA2. May cross-link plasma membrane phospholipids with actin and the cytoskeleton and be involved with exocytosis. Annexins are a family of structurally related proteins whose common property is calcium-dependent binding to phospholipids. There are at least ten different annexins in mammalian species. Annexins do not contain signal peptides, yet some annexins (A1, A2 and A5) appear to be secreted in a physiologically regulated fashion. Protein type: Calcium-binding; Motility/polarity/chemotaxis; Lipid-binding. Chromosomal Location of Human Ortholog: 15q22.2. Cellular Component: basement membrane; basolateral plasma membrane; cell cortex; cell surface; cytosol; early endosome; endosome; extracellular matrix; extracellular space; extrinsic to plasma membrane; late endosome membrane; lipid particle; lipid raft; lysosomal membrane; melanosome; membrane; midbody; nucleus; perinuclear region of cytoplasm; plasma membrane; ruffle; sarcolemma; vesicle. Molecular Function: calcium ion binding; calcium-dependent phospholipid binding; calcium-dependent protein binding; cytoskeletal protein binding; phosphatidylinositol-4,5-bisphosphate binding; phospholipase A2 inhibitor activity; protease binding; protein binding; Rab GTPase binding; receptor activator activity. Biological Process: angiogenesis; body fluid secretion; collagen fibril organization; fibrinolysis; lipid raft formation; membrane budding; muscle contraction; negative regulation of catalytic activity; negative regulation of low-density lipoprotein receptor catabolic process; negative regulation of receptor internalization; positive regulation of binding; positive regulation of fibroblast proliferation; positive regulation of protein amino acid phosphorylation; positive regulation of vesicle fusion; protein heterotetramerization
size2 :
0.01 mg (Mammalian-Cell)
size4 :
0.02 mg (Mammalian-Cell)
size7 :
0.05 mg (Mammalian-Cell)
size9 :
0.1 mg (Mammalian-Cell)
size11 :
0.05 mg (Baculovirus)
size15 :
0.1 mg (Baculovirus)
size16 :
0.5 mg (Baculovirus)
size18 :
1 mg (Baculovirus)