product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Annexin A2 (ANXA2)
catalog :
MBS968326
quantity :
0.01 mg (E-Coli)
price :
175 USD
more info or order :
image
image 1 :
MyBioSource MBS968326 image 1
product information
catalog number :
MBS968326
products type :
Recombinant Protein
products full name :
Recombinant Human Annexin A2 (ANXA2)
products short name :
[Annexin A2 (ANXA2)]
products name syn :
[Annexin II; Annexin-2; Calpactin I heavy chain; Calpactin-1 heavy chain; Chromobindin-8; Lipocortin II; Placental anticoagulant protein IV; PAP-IV; Protein I; p36]
other names :
[annexin A2 isoform 2; Annexin A2; Annexin II; Annexin-2; Calpactin I heavy chain; Calpactin-1 heavy chain; Chromobindin-8; Lipocortin II; Placental anticoagulant protein IV; PAP-IV; Protein I; p36]
products gene name :
[ANXA2]
other gene names :
[ANXA2; ANX2; ANX2L4; CAL1H; LPC2D; PAP-IV]
uniprot entry name :
ANXA2_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[2-339. Full Length of Mature Protein]
sequence :
STVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDAL
NIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRT
KKELASALKSALSGHLETVILGLLKTPAQYDASELKASM
KGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEK
DIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDAR
DLYDAGVKRKGTDVPKWISIMTERSVPHLQKVFDRYKSY
SPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFADRL
YDSMKGKGTRDKVLIRIMVSRSEVDMLKIRSEFKRKYGK
SLYYYIQQDTKGDYQKALLYLCGGDD
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
image1 heading :
SDS-PAGE
other info2 :
Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
products categories :
Signal Transduction
products description :
Calcium-regulated membrane-binding protein whose affinity for calcium is greatly enhanced by anionic phospholipids. It binds two calcium ions with high affinity. May be involved in heat-stress response.
products references :
Two human 35 kd inhibitors of phospholipase A2 are related to substrates of pp60v-src and of the epidermal growth factor receptor/kinase.Huang K.-S., Wallner B.P., Mattaliano R.J., Tizard R., Burne C., Frey A., Hession C., McGray P., Sinclair L.K., Chow E.P., Browning J.L., Ramachandran K.L., Tang J., Smart J.E., Pepinsky R.B.Cell 46:191-199(1986)
ncbi gi num :
50845386
ncbi acc num :
NP_001002857.1
ncbi gb acc num :
NM_001002857.1
uniprot acc num :
P07355
ncbi mol weight :
54.5kD
ncbi pathways :
Dissolution Of Fibrin Clot Pathway (1269372); Hemostasis Pathway (1269340); Muscle Contraction Pathway (1269868); Prostaglandin Synthesis And Regulation Pathway (198912); Smooth Muscle Contraction Pathway (1269870)
ncbi summary :
This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions as an autocrine factor which heightens osteoclast formation and bone resorption. This gene has three pseudogenes located on chromosomes 4, 9 and 10, respectively. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
uniprot summary :
ANXA2: a calcium-regulated membrane-binding protein whose affinity for calcium is greatly enhanced by anionic phospholipids. It binds two calcium ions with high affinity. Heterotetramer containing 2 light chains of S100A10 2 heavy chains of ANXA2. May cross-link plasma membrane phospholipids with actin and the cytoskeleton and be involved with exocytosis. Annexins are a family of structurally related proteins whose common property is calcium-dependent binding to phospholipids. There are at least ten different annexins in mammalian species. Annexins do not contain signal peptides, yet some annexins (A1, A2 and A5) appear to be secreted in a physiologically regulated fashion. Protein type: Calcium-binding; Motility/polarity/chemotaxis; Lipid-binding. Chromosomal Location of Human Ortholog: 15q22.2. Cellular Component: basement membrane; basolateral plasma membrane; cell cortex; cell surface; cytosol; early endosome; endosome; extracellular matrix; extracellular space; extrinsic to plasma membrane; late endosome membrane; lipid particle; lipid raft; lysosomal membrane; melanosome; membrane; midbody; nucleus; perinuclear region of cytoplasm; plasma membrane; ruffle; sarcolemma; vesicle. Molecular Function: calcium ion binding; calcium-dependent phospholipid binding; calcium-dependent protein binding; cytoskeletal protein binding; phosphatidylinositol-4,5-bisphosphate binding; phospholipase A2 inhibitor activity; protease binding; protein binding; Rab GTPase binding; receptor activator activity. Biological Process: angiogenesis; body fluid secretion; collagen fibril organization; fibrinolysis; lipid raft formation; membrane budding; muscle contraction; negative regulation of catalytic activity; negative regulation of low-density lipoprotein receptor catabolic process; negative regulation of receptor internalization; positive regulation of binding; positive regulation of fibroblast proliferation; positive regulation of protein amino acid phosphorylation; positive regulation of vesicle fusion; protein heterotetramerization
size1 :
0.01 mg (E-Coli)
price1 :
175 USD
size2 :
0.01 mg (Mammalian-Cell)
price2 :
225
size3 :
0.05 mg (E-Coli)
price3 :
225
size4 :
0.02 mg (Mammalian-Cell)
price4 :
335
size5 :
0.1 mg (E-Coli)
price5 :
360
size6 :
0.2 mg (E-Coli)
price6 :
575
size7 :
0.05 mg (Mammalian-Cell)
price7 :
635
size8 :
0.05 mg (Yeast)
price8 :
865
size9 :
0.1 mg (Mammalian-Cell)
price9 :
880
size10 :
0.5 mg (E-Coli)
price10 :
945
size11 :
0.05 mg (Baculovirus)
price11 :
1075
size12 :
0.2 mg (Yeast)
price12 :
1165
size13 :
0.5 mg (Yeast)
price13 :
1315
size14 :
1 mg (E-Coli)
price14 :
1445
size15 :
0.1 mg (Baculovirus)
price15 :
1555
size16 :
0.5 mg (Baculovirus)
price16 :
2030
size17 :
1 mg (Yeast)
price17 :
2080
size18 :
1 mg (Baculovirus)
price18 :
3140
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!