product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Rat Sulfotransferase 1A1 (Sult1a1)
catalog :
MBS968322
quantity :
0.5 mg (E-Coli)
price :
1050 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS968322
products type :
Recombinant Protein
products full name :
Recombinant Rat Sulfotransferase 1A1 (Sult1a1)
products short name :
Sulfotransferase 1A1 (Sult1a1)
products name syn :
Sulfotransferase 1A1; ST1A1; EC=2.8.2.1; Aryl sulfotransferase; Aryl sulfotransferase IV; ASTIV; Minoxidil sulfotransferase; Mx-ST; PST-1; Phenol sulfotransferase; Sulfokinase; Tyrosine-ester sulfotransferase
other names :
sulfotransferase 1A1; Sulfotransferase 1A1; sulfotransferase 1A1; sulfokinase; aryl sulfotransferase IV; minoxidil sulfotransferase; Phenol sulfotransferase 1a1; tyrosine-ester sulfotransferase; sulfotransferase family 1A, phenol-preferring, member 1; sulfotransferase family, cytosolic, 1A, phenol preferring; Aryl sulfotransferase cytosolic 1A phenol-preferring member 3; sulphotransferase family cytosolic 1A phenol-prefering member 1; Aryl sulfotransferase cytosolic, 1A, phenol-preferring, member 3; sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1; Aryl sulfotransferase; Aryl sulfotransferase IV; ASTIV; Minoxidil sulfotransferase; Mx-ST; PST-1; Phenol sulfotransferase; Sulfokinase; Tyrosine-ester sulfotransferase
products gene name :
Sult1a1
products gene name syn :
Sult1a1; St1a1
other gene names :
Sult1a1; Sult1a1; Stm; Stp1; ASTIV; Mx-ST; PST-1; St1a1; Sult1a3; St1a1; ST1A1; ASTIV; Mx-ST
uniprot entry name :
ST1A1_RAT
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-291, Full length
sequence length :
291
sequence :
MEFSRPPLVHVKGIPLIKYFAETIGPLQNFTAWPDDLLI
STYPKSGTTWMSEILDMIYQGGKLEKCGRAPIYARVPFL
EFKCPGVPSGLETLEETPAPRLLKTHLPLSLLPQSLLDQ
KVKVIYIARNAKDVVVSYYNFYNMAKLHPDPGTWDSFLE
NFMDGEVSYGSWYQHVKEWWELRHTHPVLYLFYEDIKEN
PKREIKKILEFLGRSLPEETVDSIVHHTSFKKMKENCMT
NYTTIPTEIMDHNVSPFMRKGTTGDWKNTFTVAQNERFD
AHYAKTMTDCDFKFRCEL
purity :
>90%
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
other info1 :
Species: Rattus norvegicus (Rat)
ncbi gi num :
13929194
ncbi acc num :
NP_114022.1
ncbi gb acc num :
NM_031834.1
uniprot acc num :
P17988
ncbi mol weight :
33,906 Da
ncbi pathways :
Chemical Carcinogenesis Pathway (673233); Chemical Carcinogenesis Pathway (673237); Estrogen Metabolism Pathway (219760); Metapathway Biotransformation (219788); Retinol Metabolism Pathway (219784)
uniprot summary :
SULT1A1: Sulfotransferase that utilizes 3 -phospho-5 -adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of catecholamines, phenolic drugs and neurotransmitters. Has also estrogen sulfotransferase activity. responsible for the sulfonation and activation of minoxidil. Is Mediates the metabolic activation of carcinogenic N- hydroxyarylamines to DNA binding products and could so participate as modulating factor of cancer risk. Belongs to the sulfotransferase 1 family. 2 isoforms of the human protein are produced by alternative splicing. Protein type: EC 2.8.2.1; Energy Metabolism - sulfur; Transferase. Cellular Component: cytosol. Molecular Function: sulfotransferase activity; protein homodimerization activity; steroid sulfotransferase activity; 3 -phosphoadenosine 5 -phosphosulfate binding; nucleotide binding; flavonol 3-sulfotransferase activity; aryl sulfotransferase activity. Biological Process: estrogen metabolic process; flavonoid metabolic process; regulation of blood pressure; xenobiotic metabolic process; 4-nitrophenol metabolic process; response to glucocorticoid stimulus; sulfation; catecholamine metabolic process; response to activity; drug metabolic process; response to insecticide
size1 :
0.5 mg (E-Coli)
price1 :
1050 USD
size2 :
0.05 mg (Baculovirus)
price2 :
1050
size3 :
0.05 mg (Mammalian-Cell)
price3 :
1275
size4 :
0.5 mg (Yeast)
price4 :
1275
size5 :
1 mg (E-Coli)
price5 :
1610
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!