product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Bone morphogenetic protein 1
catalog :
MBS968295
quantity :
0.05 mg (E-Coli)
price :
185 USD
more info or order :
product information
catalog number :
MBS968295
products type :
Recombinant Protein
products full name :
Recombinant Human Bone morphogenetic protein 1
products short name :
Bone morphogenetic protein 1
products name syn :
Mammalian tolloid protein; mTld; Procollagen C-proteinase; PCP
other names :
bone morphogenetic protein 1 isoform 1; Bone morphogenetic protein 1; bone morphogenetic protein 1; bone morphogenetic protein 1; Mammalian tolloid protein; mTld; Procollagen C-proteinase; PCP
products gene name :
BMP1
products gene name syn :
PCOLC
other gene names :
BMP1; BMP1; PCP; TLD; OI13; PCP2; PCOLC; PCOLC; BMP-1; mTld; PCP
uniprot entry name :
BMP1_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
121-986
sequence length :
730
sequence :
AATSRPERVWPDGVIPFVIGGNFTGSQRAVFRQAMRHWE
KHTCVTFLERTDEDSYIVFTYRPCGCCSYVGRRGGGPQA
ISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDRHVSIV
RENIQPGQEYNFLKMEPQEVESLGETYDFDSIMHYARNT
FSRGIFLDTIVPKYEVNGVKPPIGQRTRLSKGDIAQARK
LYKCPACGETLQDSTGNFSSPEYPNGYSAHMHCVWRISV
TPGEKIILNFTSLDLYRSRLC
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Developmental Biology
products description :
Cleaves the C-terminal propeptides of procollagen I, II and III. Induces cartilage and bone formation. May participate in dorsoventral patterning during early development by cleaving chordin (CHRD). Responsible for the proteolytic activation of lysyl oxidase LOX.
products references :
The C-proteinase that processes procollagens to fibrillar collagens is identical to the protein previously identified as bone morphogenic protein-1.Li S.W., Sieron A.L., Fertala A., Hojima Y., Arnold W.V., Prockop D.J.Proc. Natl. Acad. Sci. U.S.A. 93:5127-5130(1996) Novel regulators of bone formation molecular clones and activities.Wozney J.M., Rosen V., Celeste A.J., Mitsock L.M., Whitters M.J., Kriz R.W., Hewick R.M., Wang E.A.Science 242:1528-1534(1988) Three alternatively spliced variants of the gene coding for the human bone morphogenetic protein-1.Janitz M., Heiser V., Boettcher U., Landt O., Lauster R.J. Mol. Med. 76:141-146(1998) Bone morphogenetic protein-1 and a mammalian tolloid homologue (mTld) are encoded by alternatively spliced transcripts which are differentially expressed in some tissues.Takahara K., Lyons G.E., Greenspan D.S.J. Biol. Chem. 269:32572-32578(1994)
ncbi gi num :
4502421
ncbi acc num :
NP_001190.1
ncbi gb acc num :
NM_001199.3
uniprot acc num :
P13497
ncbi mol weight :
102.1kD
ncbi pathways :
Adipogenesis Pathway (198832); Anchoring Fibril Formation Pathway (1270248); Assembly Of Collagen Fibrils And Other Multimeric Structures Pathway (1270247); Cardiac Progenitor Differentiation Pathway (712094); Collagen Biosynthesis And Modifying Enzymes Pathway (1270246); Collagen Formation Pathway (1270245); Crosslinking Of Collagen Fibrils Pathway (1270249); Degradation Of The Extracellular Matrix Pathway (1270257); Extracellular Matrix Organization Pathway (1270244); HDL-mediated Lipid Transport Pathway (1270007)
ncbi summary :
This gene encodes a protein that is capable of inducing formation of cartilage in vivo. Although other bone morphogenetic proteins are members of the TGF-beta superfamily, this gene encodes a protein that is not closely related to other known growth factors. This gene is expressed as alternatively spliced variants that share an N-terminal protease domain but differ in their C-terminal region. [provided by RefSeq, Aug 2008]
uniprot summary :
BMP1: Cleaves the C-terminal propeptides of procollagen I, II and III. Induces cartilage and bone formation. May participate in dorsoventral patterning during early development by cleaving chordin (CHRD). Defects in BMP1 are a cause of autosomal recessive osteogenesis imperfecta (AR-OI). A connective tissue disorder characterized by bone fragility, progressively deforming bones, bowing of limbs due to multiple fractures, very short stature, a triangular face, severe scoliosis, and grayish sclera. AR-OI due to BMP1 mutations belongs to the group of osteogenesis imperfecta type III in the Sillence classification. Belongs to the peptidase M12A family. 7 isoforms of the human protein are produced by alternative splicing. Protein type: EC 3.4.24.19; Protease; Cytokine. Chromosomal Location of Human Ortholog: 8p21.3. Cellular Component: extracellular region; extracellular space; Golgi apparatus; proteinaceous extracellular matrix. Molecular Function: calcium ion binding; cytokine activity; growth factor activity; metalloendopeptidase activity; metallopeptidase activity; peptidase activity; protein binding; transforming growth factor beta receptor binding; zinc ion binding. Biological Process: BMP signaling pathway; cartilage condensation; cell development; extracellular matrix disassembly; extracellular matrix organization and biogenesis; lipoprotein metabolic process; multicellular organismal development; ossification; proteolysis; regulation of apoptosis; regulation of MAPKKK cascade; skeletal development. Disease: Osteogenesis Imperfecta, Type Xiii
size1 :
0.05 mg (E-Coli)
price1 :
185 USD
size2 :
0.2 mg (E-Coli)
price2 :
420
size3 :
0.5 mg (E-Coli)
price3 :
680
size4 :
1 mg (E-Coli)
price4 :
1070
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!