catalog number :
MBS968277
products type :
Recombinant Protein
products full name :
Recombinant Human Actin, alpha skeletal muscle
products short name :
Actin, alpha skeletal muscle
products name syn :
Alpha-actin-1
other names :
actin, alpha skeletal muscle; Actin, alpha skeletal muscle; actin, alpha skeletal muscle; actin, alpha 1, skeletal muscle; Alpha-actin-1
products gene name :
ACTA1
other gene names :
ACTA1; ACTA1; ACTA; ASMA; CFTD; MPFD; NEM1; NEM2; NEM3; CFTD1; CFTDM; ACTA
uniprot entry name :
ACTS_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
3-377
sequence :
DEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPR
HQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITN
WDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANRE
KMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSG
DGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTE
RGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSS
SLEKSYELPDGQVITIGNERF
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Signal Transduction
products description :
Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.
products references :
Isolation and characterization of cDNA clones for human skeletal muscle alpha actin.Hanauer A., Levin M., Heilig R., Daegelen D., Kahn A., Mandel J.-L.Nucleic Acids Res. 11:3503-3516(1983)
Nucleotide sequence and expression of the human skeletal alpha-actin gene
evolution of functional regulatory domains.Taylor A., Erba H.P., Muscat G.E.O., Kedes L.Genomics 3:323-336(1988)
Mutations in the skeletal muscle alpha-actin gene in patients with actin myopathy and nemaline myopathy.Nowak K.J., Wattanasirichaigoon D., Goebel H.H., Wilce M., Pelin K., Donner K., Jacob R.L., Hubner C., Oexle K., Anderson J.R., Verity C.M., North K.N.Nat. Genet. 23:208-212(1999)
ncbi acc num :
NP_001091.1
ncbi gb acc num :
NP_001091.1
ncbi pathways :
Caspase Cascade In Apoptosis Pathway (137974); Hypothetical Network For Drug Addiction Pathway (198776); Myometrial Relaxation And Contraction Pathways (198759); RhoA Signaling Pathway (169356); Signaling Events Mediated By Focal Adhesion Kinase Pathway (169348); Striated Muscle Contraction Pathway (198903)
ncbi summary :
The product encoded by this gene belongs to the actin family of proteins, which are highly conserved proteins that play a role in cell motility, structure and integrity. Alpha, beta and gamma actin isoforms have been identified, with alpha actins being a major constituent of the contractile apparatus, while beta and gamma actins are involved in the regulation of cell motility. This actin is an alpha actin that is found in skeletal muscle. Mutations in this gene cause nemaline myopathy type 3, congenital myopathy with excess of thin myofilaments, congenital myopathy with cores, and congenital myopathy with fiber-type disproportion, diseases that lead to muscle fiber defects. [provided by RefSeq, Jul 2008]
uniprot summary :
ACTA1: Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. Polymerization of globular actin (G-actin) leads to a structural filament (F-actin) in the form of a two-stranded helix. Each actin can bind to 4 others. Interacts with TTID. Interacts (via its C-terminus) with USP25; the interaction occurs for all USP25 isoforms but is strongest for isoform USP25m in muscle differentiating cells. Belongs to the actin family. Protein type: Contractile; Motility/polarity/chemotaxis; Cell development/differentiation; Cytoskeletal. Chromosomal Location of Human Ortholog: 1q42.13. Cellular Component: actin cytoskeleton; actin filament; cytosol; extracellular space; filopodium; lamellipodium; sarcomere; stress fiber; striated muscle thin filament. Molecular Function: ADP binding; ATP binding; myosin binding; protein binding; structural constituent of cytoskeleton. Biological Process: cell growth; muscle contraction; muscle filament sliding; muscle thin filament assembly; response to extracellular stimulus; response to lithium ion; response to mechanical stimulus; response to steroid hormone stimulus; skeletal muscle fiber adaptation; skeletal muscle fiber development. Disease: Myopathy, Congenital, With Fiber-type Disproportion; Nemaline Myopathy 3
size4 :
0.05 mg (Baculovirus)