product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human CD63 antigen (CD63)
catalog :
MBS968215
quantity :
0.5 mg (E-Coli)
price :
835 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS968215
products type :
Recombinant Protein
products full name :
Recombinant Human CD63 antigen (CD63)
products short name :
CD63 antigen (CD63)
products name syn :
Recombinant CD63 antigen (CD63); CD63 antigen; Granulophysin Lysosomal-associated membrane protein 3; LAMP-3 Melanoma-associated antigen ME491 OMA81H Ocular melanoma-associated antigen Tetraspanin-30; Tspan-30 CD_antigen= CD63
other names :
CD63 antigen isoform A; CD63 antigen; CD63 antigen; tspan-30; granulophysin; tetraspanin-30; melanoma-associated antigen MLA1; CD63 antigen (melanoma 1 antigen); melanoma-associated antigen ME491; ocular melanoma-associated antigen; lysosomal-associated membrane protein 3; lysosome-associated membrane glycoprotein 3; CD63 molecule; Granulophysin; Lysosomal-associated membrane protein 3; LAMP-3; Melanoma-associated antigen ME491; OMA81H; Ocular melanoma-associated antigen; Tetraspanin-30
products gene name syn :
CD63; MLA1, TSPAN30
other gene names :
CD63; CD63; MLA1; ME491; LAMP-3; OMA81H; TSPAN30; MLA1; TSPAN30; LAMP-3; Tspan-30
uniprot entry name :
CD63_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
103-203, Partial, provide one of the two extracellular domains.
sequence length :
203
sequence :
AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQA
DFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGIN
FNEKAIHKEGCVEKIGGWLRKNV
purity :
>90%
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Species: Homo sapiens (Human)
ncbi gi num :
383872447
ncbi acc num :
NP_001244318.1
ncbi gb acc num :
NM_001257389.1
uniprot acc num :
P08962
ncbi mol weight :
37 kDa
ncbi pathways :
Hemostasis Pathway (106028); Lysosome Pathway (99052); Lysosome Pathway (96865); Platelet Activation, Signaling And Aggregation Pathway (106034); Platelet Degranulation Pathway (106050); Response To Elevated Platelet Cytosolic Ca2+ Pathway (106048)
ncbi summary :
The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The encoded protein is a cell surface glycoprotein that is known to complex with integrins. It may function as a blood platelet activation marker. Deficiency of this protein is associated with Hermansky-Pudlak syndrome. Also this gene has been associated with tumor progression. Alternative splicing results in multiple transcript variants encoding different protein isoforms. [provided by RefSeq, Apr 2012]
uniprot summary :
CD63: This antigen is associated with early stages of melanoma tumor progression. May play a role in growth regulation. Belongs to the tetraspanin (TM4SF) family. Protein type: Membrane protein, integral; Membrane protein, multi-pass. Chromosomal Location of Human Ortholog: 12q12-q13. Cellular Component: cell surface; late endosome membrane; lysosomal membrane; integral to plasma membrane; melanosome; plasma membrane; platelet dense granule membrane; endosome membrane; intrinsic to plasma membrane. Molecular Function: protein binding. Biological Process: platelet activation; cell migration; protein transport; platelet degranulation; pigment granule maturation; cell-matrix adhesion; positive regulation of receptor internalization; blood coagulation
size1 :
0.5 mg (E-Coli)
price1 :
835 USD
size2 :
0.05 mg (Baculovirus)
price2 :
835
size3 :
0.05 mg (Mammalian-Cell)
price3 :
1060
size4 :
0.5 mg (Yeast)
price4 :
1060
size5 :
1 mg (E-Coli)
price5 :
1175
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!