Recombinant Mouse Calcium-dependent phospholipase A2 | MyBioSource MBS968147 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Mouse Calcium-dependent phospholipase A2

catalog :

MBS968147

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS968147

products type :

Recombinant Protein

products full name :

Recombinant Mouse Calcium-dependent phospholipase A2

products short name :

Calcium-dependent phospholipase A2

products name syn :

Group V phospholipase A2; PLA2-10; Phosphatidylcholine 2-acylhydrolase 5

other names :

calcium-dependent phospholipase A2; Calcium-dependent phospholipase A2; calcium-dependent phospholipase A2; phospholipase A2, group V; Group V phospholipase A2; PLA2-10; Phosphatidylcholine 2-acylhydrolase 5

products gene name :

Pla2g5

other gene names :

Pla2g5; Pla2g5; PLA2; sPLA2

uniprot entry name :

PA2G5_MOUSE

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

21-137

sequence length :

137

sequence :

GLLELKSMIEKVTGKNAFKNYGFYGCYCGWGGRGTPKDG
TDWCCQMHDRCYGQLEEKDCAIRTQSYDYRYTNGLVICE
HDSFCPMRLCACDRKLVYCLRRNLWTYNPLYQYYPNFLC

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products description :

PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. This isozyme hydrolyzes L-alpha-palmitoyl-2-oleoyl phosphatidylcholine more efficiently than L-alpha-1-palmitoyl-2-arachidonyl phosphatidylcholine, L-alpha-1-palmitoyl-2-arachidonyl phosphatidylethanolamine or L-alpha-1-stearoyl-2-arachidonyl phosphatidylinositol.

products references :

Low-molecular-weight, calcium-dependent phospholipase A2 genes are linked and map to homologous chromosome regions in mouse and human.Tischfield J.A., Xia Y.R., Shih D.M., Klisak I., Chen J., Engle S.J., Siakotos A.N., Winstead M.V., Seilhamer J.J., Allamand V., Gyapay G., Lusis A.Genomics 32:328-333(1996) Low molecular weight group IIA and group V phospholipase A(2) enzymes have different intracellular locations in mouse bone marrow-derived mast cells.Bingham C.O. III, Fijneman R.J.A., Friend D.S., Goddeau R.P., Rogers R.A., Austen K.F., Arm J.P.J. Biol. Chem. 274:31476-31484(1999)

ncbi gi num :

171906563

ncbi acc num :

NP_001116426.1

ncbi gb acc num :

NM_001122954.1

uniprot acc num :

P97391

ncbi mol weight :

29.8kD

ncbi pathways :

Acyl Chain Remodelling Of PC Pathway (1324325); Acyl Chain Remodelling Of PE Pathway (1324321); Acyl Chain Remodelling Of PG Pathway (1324332); Acyl Chain Remodelling Of PI Pathway (1324330); Acyl Chain Remodelling Of PS Pathway (1324328); Arachidonic Acid Metabolism Pathway (83190); Arachidonic Acid Metabolism Pathway (366); Arachidonic Acid Metabolism Pathway (522975); Ether Lipid Metabolism Pathway (83189); Ether Lipid Metabolism Pathway (365)

uniprot summary :

PLA2G5: PA2 catalyzes the calcium-dependent hydrolysis of the 2- acyl groups in 3-sn-phosphoglycerides. This isozyme hydrolyzes more efficiently L-alpha-1-palmitoyl-2-oleoyl phosphatidylcholine than L-alpha-1-palmitoyl-2-arachidonyl phosphatidylcholine, L- alpha-1-palmitoyl-2-arachidonyl phosphatidylethanolamine, or L- alpha-1-stearoyl-2-arachidonyl phosphatidylinositol. May be involved in the production of lung surfactant, the remodeling or regulation of cardiac muscle. Defects in PLA2G5 are the cause of fleck retina, familial benign (FRFB). An autosomal recessive condition associated with a distinctive retinal appearance and no apparent visual or electrophysiologic deficits. Affected individuals are asymptomatic, but fundus examination reveals a striking pattern of diffuse, yellow-white, fleck-like lesions extending to the far periphery of the retina but sparing the foveal region. Belongs to the phospholipase A2 family. Protein type: Secreted, signal peptide; Secreted; Phospholipase; Lipid Metabolism - alpha-linolenic acid; Lipid Metabolism - arachidonic acid; Lipid Metabolism - linoleic acid; Lipid Metabolism - glycerophospholipid; EC 3.1.1.4; Lipid Metabolism - ether lipid; Cell surface. Cellular Component: cell surface; extracellular region; Golgi apparatus; membrane; perinuclear region of cytoplasm; plasma membrane. Molecular Function: calcium ion binding; calcium-dependent phospholipase A2 activity; heparin binding; hydrolase activity; metal ion binding; phospholipase A2 activity; receptor binding. Biological Process: arachidonic acid secretion; leukotriene biosynthetic process; lipid catabolic process; lipid metabolic process; phospholipid metabolic process; platelet activating factor biosynthetic process

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

0.05 mg (Baculovirus)

price4 :

850

size5 :

0.05 mg (Mammalian-Cell)

price5 :

1075

more info or order :

MyBioSource product webpage