product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Kallikrein-2 (KLK2)
catalog :
MBS968094
quantity :
0.05 mg (E-Coli)
price :
180 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS968094
products type :
Recombinant Protein
products full name :
Recombinant Human Kallikrein-2 (KLK2)
products short name :
Kallikrein-2 (KLK2)
products name syn :
Kallikrein-2; EC=3.4.21.35; Glandular kallikrein-1; hGK-1; Tissue kallikrein-2
other names :
kallikrein-2 isoform 2 preproprotein; Kallikrein-2; kallikrein-2; tissue kallikrein-2; glandular kallikrein 2; glandular kallikrein-1; kallikrein 2, prostatic; kallikrein-related peptidase 2; Glandular kallikrein-1; hGK-1; Tissue kallikrein-2
products gene name :
KLK2
other gene names :
KLK2; KLK2; hK2; hGK-1; KLK2A2; hGK-1
uniprot entry name :
KLK2_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
25-261, Mature full length protein.
sequence length :
261
sequence :
IVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTA
AHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYN
MSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGL
PTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLS
NDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVC
NGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIA
ANP
purity :
>90%
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
other info1 :
Species: Homo sapiens (Human)
ncbi gi num :
50363237
ncbi acc num :
NP_001002231.1
ncbi gb acc num :
NM_001002231.2
uniprot acc num :
P20151
ncbi mol weight :
17,301 Da
ncbi pathways :
Activation Of Matrix Metalloproteinases Pathway (576264); Coregulation Of Androgen Receptor Activity Pathway (138085); Degradation Of The Extracellular Matrix Pathway (576263); Endocrine And Other Factor-regulated Calcium Reabsorption Pathway (213307); Endocrine And Other Factor-regulated Calcium Reabsorption Pathway (213276); Extracellular Matrix Organization Pathway (576262); Metabolism Of Proteins Pathway (106230); Prostate Cancer Pathway (755440); Regulation Of Androgen Receptor Activity Pathway (138027); Regulation Of Insulin-like Growth Factor (IGF) Transport And Uptake By Insulin-like Growth Factor Binding Proteins (IGFBPs) Pathway (105908)
ncbi summary :
This gene encodes a member of the grandular kallikrein protein family. Kallikreins are a subgroup of serine proteases that are clustered on chromosome 19. Members of this family are involved in a diverse array of biological functions. The protein encoded by this gene is a highly active trypsin-like serine protease that selectively cleaves at arginine residues. This protein is primarily expressed in prostatic tissue and is responsible for cleaving pro-prostate-specific antigen into its enzymatically active form. This gene is highly expressed in prostate tumor cells and may be a prognostic maker for prostate cancer risk. Alternate splicing results in both coding and non-coding transcript variants. [provided by RefSeq, Jan 2012]
uniprot summary :
KLK2: Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin. Belongs to the peptidase S1 family. Kallikrein subfamily. 3 isoforms of the human protein are produced by alternative splicing. Protein type: EC 3.4.21.35; Protease. Chromosomal Location of Human Ortholog: 19q13.41. Cellular Component: extracellular region. Molecular Function: serine-type endopeptidase activity. Biological Process: extracellular matrix disassembly; extracellular matrix organization and biogenesis; proteolysis
size1 :
0.05 mg (E-Coli)
price1 :
180 USD
size2 :
0.2 mg (E-Coli)
price2 :
490
size3 :
0.5 mg (E-Coli)
price3 :
715
size4 :
0.05 mg (Baculovirus)
price4 :
950
size5 :
1 mg (E-Coli)
price5 :
1170
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!