Recombinant Human Atrial natriuretic peptide receptor 2 | MyBioSource MBS968089 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Atrial natriuretic peptide receptor 2

catalog :

MBS968089

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS968089

products type :

Recombinant Protein

products full name :

Recombinant Human Atrial natriuretic peptide receptor 2

products short name :

Atrial natriuretic peptide receptor 2

products name syn :

Atrial natriuretic peptide receptor type B; ANP-B; ANPR-B; NPR-B; Guanylate cyclase B; GC-B

other names :

atrial natriuretic peptide receptor 2; Atrial natriuretic peptide receptor 2; atrial natriuretic peptide receptor 2; natriuretic peptide receptor 2; Atrial natriuretic peptide receptor type B; ANP-B; ANPR-B; NPR-B; Guanylate cyclase B; GC-B

products gene name :

NPR2

other gene names :

NPR2; NPR2; AMDM; ANPb; ECDM; NPRB; SNSK; ANPRB; GUC2B; NPRBi; GUCY2B; ANPRB; ANP-B; ANPR-B; NPR-B; GC-B

uniprot entry name :

ANPRB_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

23-458

sequence length :

1047

sequence :

RNLTLAVVLPEHNLSYAWAWPRVGPAVALAVEALGRALP
VDLRFVSSELEGACSEYLAPLSAVDLKLYHDPDLLLGPG
CVYPAASVARFASHWRLPLLTAGAVASGFSAKNDHYRTL
VRTGPSAPKLGEFVVTLHGHFNWTARAALLYLDARTDDR
PHYFTIEGVFEALQGSNLSVQHQVYAREPGGPEQATHFI
RANGRIVYICGPLEMLHEILLQAQRENLTNGDYVFFYLD
VFGESLRAGPTRATGRPWQDN

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Cardiovascular

products description :

Receptor for the C-type natriuretic peptide NPPC/CNP hormone. Has guanylate cyclase activity upon binding of its ligand. May play a role in the regulation of skeletal growth.

products references :

Differential activation by atrial and brain natriuretic peptides of two different receptor guanylate cyclases.Chang M.S., Lowe D.G., Lewis M., Hellmiss R., Chen E., Goeddel D.V.Nature 341:68-72(1989) Structure of the type B human natriuretic peptide receptor gene and association of a novel microsatellite polymorphism with essential hypertension.Rehemudula D., Nakayama T., Soma M., Takahashi Y., Uwabo J., Sato M., Izumi Y., Kanmatsuse K., Ozawa Y.Circ. Res. 84:605-610(1999) cGMP-dependent and -independent inhibition of a K+ conductance by natriuretic peptides molecular and functional studies in human proximal tubule cells.Hirsch J.R., Meyer M., Maegert H.-J., Forssmann W.-G., Mollerup S., Herter P., Weber G., Cermak R., Ankorina-Stark I., Schlatter E., Kruhoffer M.J. Am. Soc. Nephrol. 10:472-480(1999) DNA sequence and analysis of human chromosome 9.Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.Nature 429:369-374(2004)

ncbi gi num :

4580422

ncbi acc num :

NP_003986.2

ncbi gb acc num :

NM_003995.3

uniprot acc num :

P20594

ncbi mol weight :

64.5kD

ncbi pathways :

Cardiac Conduction Pathway (1339115); Muscle Contraction Pathway (1269868); Oxytocin Signaling Pathway (952859); Oxytocin Signaling Pathway (960764); Physiological Factors Pathway (1339122); Purine Metabolism Pathway (82944); Purine Metabolism Pathway (307); Vascular Smooth Muscle Contraction Pathway (96530); Vascular Smooth Muscle Contraction Pathway (96866); CGMP Signaling Pathway (1084770)

ncbi summary :

This gene encodes natriuretic peptide receptor B, one of two integral membrane receptors for natriuretic peptides. Both NPR1 and NPR2 contain five functional domains: an extracellular ligand-binding domain, a single membrane-spanning region, and intracellularly a protein kinase homology domain, a helical hinge region involved in oligomerization, and a carboxyl-terminal guanylyl cyclase catalytic domain. The protein is the primary receptor for C-type natriuretic peptide (CNP), which upon ligand binding exhibits greatly increased guanylyl cyclase activity. Mutations in this gene are the cause of acromesomelic dysplasia Maroteaux type. [provided by RefSeq, Jul 2008]

uniprot summary :

ANPB: natriuretic peptide receptor B, one of two integral membrane receptors for natriuretic peptides. Contains five functional domains: an extracellular ligand-binding domain, a single membrane-spanning region, and intracellularly a protein kinase homology domain, a helical hinge region involved in oligomerization, and a carboxyl-terminal guanylyl cyclase catalytic domain. Is the primary receptor for C-type natriuretic peptide (CNP), which upon ligand binding exhibits greatly increased guanylyl cyclase activity. 21 mutations linked to acromesomelic dysplasia (skeletal malformation). 3 isoforms of the human protein are produced by alternative splicing. Protein type: Kinase, protein; EC 4.6.1.2; Receptor, misc.; Protein kinase, dual-specificity (receptor); Nucleotide Metabolism - purine; Protein kinase, RGC; Lyase; Guanylyl cyclase; Membrane protein, integral; RGC group; RGC family. Chromosomal Location of Human Ortholog: 9p21-p12. Cellular Component: guanylate cyclase complex, soluble; integral to membrane; plasma membrane. Molecular Function: adenylate cyclase activity; ATP binding; GTP binding; guanylate cyclase activity; hormone binding; identical protein binding; natriuretic peptide receptor activity; peptide hormone binding; protein kinase activity; receptor activity; transmembrane receptor activity. Biological Process: cell surface receptor linked signal transduction; cGMP biosynthetic process; negative regulation of meiotic cell cycle; ossification; protein amino acid phosphorylation; receptor guanylyl cyclase signaling pathway; regulation of blood pressure; signal transduction. Disease: Acromesomelic Dysplasia, Maroteaux Type; Epiphyseal Chondrodysplasia, Miura Type; Short Stature With Nonspecific Skeletal Abnormalities

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

1 mg (E-Coli)

price4 :

1180

size5 :

0.05 mg (Baculovirus)

price5 :

1215

more info or order :

MyBioSource product webpage