Recombinant Mouse Integrin alpha-L | MyBioSource MBS968085 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Mouse Integrin alpha-L

catalog :

MBS968085

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS968085

products type :

Recombinant Protein

products full name :

Recombinant Mouse Integrin alpha-L

products short name :

Integrin alpha-L

products name syn :

CD11 antigen-like family member A; Leukocyte adhesion glycoprotein LFA-1 alpha chain; LFA-1A; Leukocyte function-associated molecule 1 alpha chain; Lymphocyte antigen 15; Ly-15; CD11a

other names :

Integrin alpha-L; Integrin alpha-L; integrin alpha-L; integrin alpha L; CD11 antigen-like family member A; Leukocyte adhesion glycoprotein LFA-1 alpha chain; LFA-1A; Leukocyte function-associated molecule 1 alpha chain; Lymphocyte antigen 15; Ly-15; CD_antigen: CD11a

products gene name :

Itgal

products gene name syn :

Lfa-1; Ly-15

other gene names :

Itgal; Itgal; Cd11a; LFA-1; Ly-15; Ly-21; (p180); LFA-1A; Lfa-1; Ly-15; LFA-1A; Ly-15

uniprot entry name :

ITAL_MOUSE

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

153-325

sequence length :

1163

sequence :

DLVFLFDGSQSLDRKDFEKILEFMKDVMRKLSNTSYQFA
AVQFSTDCRTEFTFLDYVKQNKNPDVLLGSVQPMFLLTN
TFRAINYVVAHVFKEESGARPDATKVLVIITDGEASDKG
NISAAHDITRYIIGIGKHFVSVQKQKTLHIFASEPVEEF
VKILDTFEKLKDLFTDL

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products description :

Integrin alpha-L/beta-2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. Is involved in a variety of immune phenomena including leukocyte-endothelial cell interaction, cytotoxic T-cell mediated killing, and antibody dependent killing by granulocytes and monocytes. Mice expressing a null mutation of the alpha-L subunit gene donstrate impaired tumor rejection and impaired leukocytes recruitment.

products references :

Cloning of the murine lymphocyte function-associated molecule-1 alpha-subunit and its expression in COS cells.Kaufmann Y., Tseng E., Springer T.A.J. Immunol. 147:369-374(1991) Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) Sequence homology of the LFA-1 and Mac-1 leukocyte adhesion glycoproteins and unexpected relation to leukocyte interferon.Springer T.A., Teplow D.B., Dreyer W.J.Nature 314:540-542(1985)

ncbi gi num :

341940846

ncbi acc num :

P24063.2

uniprot acc num :

P24063

ncbi mol weight :

23.8kD

ncbi pathways :

Adaptive Immune System Pathway (1323640); Cell Adhesion Molecules (CAMs) Pathway (83266); Cell Adhesion Molecules (CAMs) Pathway (480); Cell Surface Interactions At The Vascular Wall Pathway (1323592); Epstein-Barr Virus Infection Pathway (585576); Epstein-Barr Virus Infection Pathway (587115); Extracellular Matrix Organization Pathway (1323909); Focal Adhesion Pathway (198353); HTLV-I Infection Pathway (373903); HTLV-I Infection Pathway (373889)

uniprot summary :

ITGAL: Integrin alpha-L/beta-2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. It is involved in a variety of immune phenomena including leukocyte-endothelial cell interaction, cytotoxic T-cell mediated killing, and antibody dependent killing by granulocytes and monocytes. Belongs to the integrin alpha chain family. 3 isoforms of the human protein are produced by alternative splicing. Protein type: Cell adhesion; Motility/polarity/chemotaxis; Membrane protein, integral; Cell surface. Cellular Component: cell surface; external side of plasma membrane; immunological synapse; integral to membrane; integrin complex; intercellular junction; membrane. Molecular Function: cell adhesion molecule binding; ICAM-3 receptor activity; metal ion binding; protein complex binding; protein heterodimerization activity. Biological Process: activated T cell proliferation; cell adhesion; cell surface receptor linked signal transduction; cell-cell adhesion; cell-matrix adhesion; heterophilic cell adhesion; integrin-mediated signaling pathway; leukocyte adhesion; positive regulation of calcium-mediated signaling; positive regulation of cell-cell adhesion; positive regulation of T cell proliferation; receptor clustering; regulation of cell-cell adhesion; T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.05 mg (Yeast)

price2 :

190

size3 :

0.2 mg (E-Coli)

price3 :

460

size4 :

0.2 mg (Yeast)

price4 :

460

size5 :

0.5 mg (Yeast)

price5 :

750

more info or order :

MyBioSource product webpage