Recombinant Human Apolipoprotein B-100 | MyBioSource MBS967958 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Apolipoprotein B-100

catalog :

MBS967958

quantity :

0.01 mg (E-Coli)

price :

110 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS967958

products type :

Recombinant Protein

products full name :

Recombinant Human Apolipoprotein B-100

products short name :

Apolipoprotein B-100

products name syn :

Apolipoprotein B-48; Apo B-48

other names :

apolipoprotein B-100; Apolipoprotein B-100

products gene name :

APOB

other gene names :

APOB; Apo B-100; Apo B-48

uniprot entry name :

APOB_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

28-127

sequence length :

4563

sequence :

EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPG
TADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGF
NPEGKALLKKTKNSEEFAAAMS

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

other info2 :

Species: Homo sapiens (Human)

products categories :

Cardiovascular

products description :

Apolipoprotein B is a major protein constituent of chylomicrons (apo B-48), LDL (apo B-100) and VLDL (apo B-100). Apo B-100 functions as a recognition signal for the cellular binding and internalization of LDL particles by the apoB/E receptor.

products references :

Complete cDNA and derived protein sequence of human apolipoprotein B-100." Knott T.C., Wallis S.C., Powell L.M., Pease R.J., Lusis A.J., Blackhart B., McCarthy B.J., Mahley R.W., Levy-Wilson B., Scott J. Nucleic Acids Res. 14:7501-7503(1986)

ncbi gi num :

105990532

ncbi acc num :

NP_000375.2

ncbi gb acc num :

NM_000384.2

uniprot acc num :

P04114

ncbi mol weight :

13.19kD

ncbi pathways :

Binding And Uptake Of Ligands By Scavenger Receptors Pathway (1269897); Cell Surface Interactions At The Vascular Wall Pathway (1269373); Chylomicron-mediated Lipid Transport Pathway (1270006); FOXA1 Transcription Factor Network Pathway (137979); Fat Digestion And Absorption Pathway (194385); Fat Digestion And Absorption Pathway (194324); Hemostasis Pathway (1269340); LDL-mediated Lipid Transport Pathway (1270008); Lipid Digestion, Mobilization, And Transport Pathway (1270002); Lipoprotein Metabolism Pathway (1270005)

uniprot summary :

APOB: Apolipoprotein B is a major protein constituent of chylomicrons (apo B-48), LDL (apo B-100) and VLDL (apo B-100). Apo B-100 functions as a recognition signal for the cellular binding and internalization of LDL particles by the apoB/E receptor. Defects in APOB are a cause of familial hypobetalipoproteinemia type 1 (FHBL1). A disorder characterized by highly reduced plasma concentrations of low density lipoproteins, and dietary fat malabsorption. Clinical presentation may vary from no symptoms to severe gastrointestinal and neurological dysfunction similar to abetalipoproteinemia. Defects in APOB are a cause of familial ligand-defective apolipoprotein B-100 (FDB). FDB is a dominantly inherited disorder of lipoprotein metabolism leading to hypercholesterolemia and increased proneness to coronary artery disease (CAD). The plasma cholesterol levels are dramatically elevated due to impaired clearance of LDL particles by defective APOB/E receptors. Defects in APOB associated with defects in other genes (polygenic) can contribute to hypocholesterolemia. Protein type: Secreted; Secreted, signal peptide; Carrier. Chromosomal Location of Human Ortholog: 2p24-p23. Cellular Component: actin cytoskeleton; cell soma; chylomicron; cytoplasm; cytosol; early endosome; endoplasmic reticulum lumen; endoplasmic reticulum membrane; endosome membrane; extracellular region; extracellular space; Golgi apparatus; intracellular membrane-bound organelle; plasma membrane. Molecular Function: cholesterol transporter activity; heparin binding; low-density lipoprotein receptor binding; phospholipid binding; protein binding. Biological Process: artery morphogenesis; blood coagulation; cholesterol efflux; cholesterol homeostasis; cholesterol metabolic process; cholesterol transport; fat-soluble vitamin metabolic process; fertilization; in utero embryonic development; leukocyte migration; lipoprotein biosynthetic process; lipoprotein catabolic process; lipoprotein metabolic process; lipoprotein transport; nervous system development; phototransduction, visible light; post-embryonic development; receptor-mediated endocytosis; regulation of cholesterol biosynthetic process; response to carbohydrate stimulus; response to lipopolysaccharide; response to selenium ion; response to virus; retinoid metabolic process; sperm motility; spermatogenesis; triacylglycerol catabolic process; triacylglycerol mobilization; vitamin metabolic process. Disease: Hypercholesterolemia, Autosomal Dominant, Type B; Hypobetalipoproteinemia, Familial, 1

size1 :

0.01 mg (E-Coli)

price1 :

110 USD

size2 :

0.05 mg (E-Coli)

price2 :

190

size3 :

0.2 mg (E-Coli)

price3 :

460

size4 :

0.5 mg (E-Coli)

price4 :

750

size5 :

0.05 mg (Baculovirus)

price5 :

835

more info or order :

MyBioSource product webpage