protein

Recombinant Human Interferon alpha-21

MBS967866

0.05 mg (E-Coli)

190 USD

Recombinant Protein

Recombinant Human Interferon alpha-21

Interferon alpha-21

Interferon alpha-F; LeIF F

interferon alpha-21; Interferon alpha-21; interferon alpha-21; interferon, alpha 21; Interferon alpha-F; LeIF F

IFNA21

IFNA21; IFNA21; LeIF F; leIF-F; IFN-alphaI; IFN-alpha-21; LeIF F

IFN21_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

24-189

189

CDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGFP
QEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWE
QSLLEKFSTELNQQLNDLEACVIQEVGVEETPLMNVDSI
LAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSK
IFQERLRRKE

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Immunology

Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.

The structure of eight distinct cloned human leukocyte interferon cDNAs.Goeddel D.V., Leung D.W., Dull T.J., Gross M., Lawn R.M., McCandliss R., Seeburg P.H., Ullrich A., Yelverton E., Gray P.W.Nature 290:20-26(1981) A new type of leukocytic interferon.Gren E.Y., Berzin V.M., Tsimanis A.Y., Apsalon U.R., Vishnevskii Y.I., Yansone I.V., Dishler A.V., Pudova N.V., Smorodintsev A.A., Iovlev V.I., Stepanov A.N., Feldmane G.Y., Meldrais Y.A., Lozha V.P., Kavsan V.M., Efimov V.A., Sverdlov E.D.Dokl. Biochem. 269:91-95(1983) Novel human leukocyte interferon subtype and structural comparison of alpha interferon genes.Gren E., Berzin V.M., Jansone I., Tsimanis A., Vishnevsky Y., Apsalons U.J. Interferon Res. 4:609-617(1984) DNA sequence and analysis of human chromosome 9.Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.Nature 429:369-374(2004)

169791013

NP_002166.2

NM_002175.2

P01568

23.4kD

Autoimmune Thyroid Disease Pathway (83121); Autoimmune Thyroid Disease Pathway (533); Cytokine Signaling In Immune System Pathway (1269310); Cytokine-cytokine Receptor Interaction Pathway (83051); Cytokine-cytokine Receptor Interaction Pathway (460); Cytosolic DNA-sensing Pathway (125137); Cytosolic DNA-sensing Pathway (124833); Factors Involved In Megakaryocyte Development And Platelet Production Pathway (1269377); Hemostasis Pathway (1269340); Hepatitis B Pathway (694606)

This gene is a member of the alpha interferon gene cluster on the short arm of chromosome 9. Interferons are cytokines produced in response to viral infection that mediate the immune response and interfere with viral replication. The encoded protein is a type I interferon and may play a specific role in the antiviral response to rubella virus. [provided by RefSeq, Sep 2011]

IFNA21: Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. Belongs to the alpha/beta interferon family. Protein type: Secreted; Cytokine; Secreted, signal peptide. Chromosomal Location of Human Ortholog: 9p22. Cellular Component: extracellular region; extracellular space. Molecular Function: cytokine activity; hematopoietin/interferon-class (D200-domain) cytokine receptor binding; interferon-alpha/beta receptor binding. Biological Process: adaptive immune response; B cell differentiation; B cell proliferation; blood coagulation; cytokine and chemokine mediated signaling pathway; defense response to virus; humoral immune response; innate immune response; natural killer cell activation during immune response; positive regulation of peptidyl-serine phosphorylation of STAT protein; response to exogenous dsRNA; T cell activation during immune response

0.05 mg (E-Coli)

190 USD

0.05 mg (Yeast)

190

0.2 mg (E-Coli)

460

0.2 mg (Yeast)

460

0.5 mg (Yeast)

750