product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse Cathepsin K
catalog :
MBS967816
quantity :
0.05 mg (E-Coli)
price :
185 USD
more info or order :
product information
catalog number :
MBS967816
products type :
Recombinant Protein
products full name :
Recombinant Mouse Cathepsin K
products short name :
Cathepsin K
other names :
cathepsin K preproprotein; Cathepsin K; cathepsin K; cathepsin K
products gene name :
Ctsk
other gene names :
Ctsk; Ctsk; catK; Ms10q; MMS10-Q; AI323530
uniprot entry name :
CATK_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
115-329
sequence length :
329
sequence :
VPDSIDYRKKGYVTPVKNQGQCGSCWAFSSAGALEGQLK
KKTGKLLALSPQNLVDCVTENYGCGGGYMTTAFQYVQQN
GGIDSEDAYPYVGQDESCMYNATAKAAKCRGYREIPVGN
EKALKRAVARVGPISVSIDASLASFQFYSRGVYYDENCD
RDNVNHAVLVVGYGTQKGSKHWIIKNSWGESWGNKGYAL
LARNKNNACGITNMASFPKM
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Closely involved in osteoclastic bone resorption and may participate partially in the disorder of bone remodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in extracellular matrix degradation.
products references :
Mouse cathepsin K cDNA cloning and predominant expression of the gene in osteoclasts, and in some hypertrophying chondrocytes during mouse development.Rantakokko J.A., Aro H.T., Savontaus M., Vuorio E.FEBS Lett. 393:307-313(1996) Complete genomic structure of the mouse cathepsin K gene (Ctsk) and its localization next to the Arnt gene on mouse chromosome 3.Rantakokko J.A., Kiviranta R., Eerola R., Aro H.T., Vuorio E.Matrix Biol. 18:155-161(1999)
ncbi gi num :
31982433
ncbi acc num :
NP_031828.2
ncbi gb acc num :
NM_007802.4
uniprot acc num :
P55097
ncbi mol weight :
27.5kD
ncbi pathways :
Activation Of Matrix Metalloproteinases Pathway (1323923); Collagen Degradation Pathway (1323924); Degradation Of The Extracellular Matrix Pathway (1323922); Extracellular Matrix Organization Pathway (1323909); Immune System Pathway (1323639); Innate Immune System Pathway (1323671); Lysosome Pathway (99272); Lysosome Pathway (96865); Osteoclast Pathway (198284); Osteoclast Differentiation Pathway (193149)
ncbi summary :
This gene encodes a member of the cathepsin family of cysteine proteases that is highly expressed in osteoclasts and is involved in the degradation of collagen and other matrix proteins in bone. The encoded preproprotein undergoes proteolytic processing to generate a mature, functional enzyme. Mice lacking the encoded protein exhibit phenotypic features of pycnodysostosis such as increased bone density and bone deformity, which become progressively more pronounced with age. [provided by RefSeq, Jan 2016]
uniprot summary :
CTSK: Closely involved in osteoclastic bone resorption and may participate partially in the disorder of bone remodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in extracellular matrix degradation. Defects in CTSK are the cause of pycnodysostosis (PKND). PKND is an autosomal recessive osteochondrodysplasia characterized by osteosclerosis and short stature. Belongs to the peptidase C1 family. Protein type: EC 3.4.22.38; Protease. Cellular Component: cytoplasm; extracellular space; lysosome. Molecular Function: collagen binding; cysteine-type endopeptidase activity; cysteine-type peptidase activity; fibronectin binding; hydrolase activity; peptidase activity; proteoglycan binding. Biological Process: bone resorption; collagen catabolic process; proteolysis; proteolysis involved in cellular protein catabolic process
size1 :
0.05 mg (E-Coli)
price1 :
185 USD
size2 :
0.2 mg (E-Coli)
price2 :
420
size3 :
0.5 mg (E-Coli)
price3 :
680
size4 :
1 mg (E-Coli)
price4 :
1070
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!