catalog number :
MBS967666
products type :
Recombinant Protein
products full name :
Recombinant Mouse Nuclease-sensitive element-binding protein 1
products short name :
Nuclease-sensitive element-binding protein 1
products name syn :
CCAAT-binding transcription factor I subunit A; CBF-ADNA-binding protein B; DBPB; Enhancer factor I subunit A; EFI-AY-box transcription factor; Y-box-binding protein 1; YB-1
other names :
nuclease-sensitive element-binding protein 1; Nuclease-sensitive element-binding protein 1; nuclease-sensitive element-binding protein 1; Y box protein 1; CCAAT-binding transcription factor I subunit A; CBF-A; DNA-binding protein B; DBPB; Enhancer factor I subunit A; EFI-A; Y-box transcription factor; Y-box-binding protein 1; YB-1
products gene name :
Ybx1
other gene names :
Ybx1; Ybx1; EF1A; MSY1; YB-1; dbpB; Nsep1; C79409; mYB-1a; 1700102N10Rik; Msy-1; Msy1; Nsep1; Yb1; CBF-A; DBPB; EFI-A; YB-1
uniprot entry name :
YBOX1_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
2-322
sequence :
SSEAETQQPPAAPAAALSAADTKPGSTGSGAGSGGPGGL
TSAAPAGGDKKVIATKVLGTVKWFNVRNGYGFINRNDTK
EDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGA
EAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPPRNYQ
QNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYM
RRPYARRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNM
YRGYRPRFRRGPPRQRQPRED
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Mediates pre-mRNA alternative splicing regulation. Component of the CRD-mediated complex that promotes MYC mRNA stability. Binds to splice sites in pre-mRNA and regulates splice site selection. Binds and stabilizes cytoplasmic mRNA. Contributes to the regulation of translation by modulating the interaction between the mRNA and eukaryotic initiation factors. Binds to promoters that contain a Y-box (5'-CTGATTGGCCAA-3'), such as HLA class II genes. Regulates the transcription of numerous genes. Promotes separation of DNA strands that contain mismatches or are modified by cisplatin. Has endonucleolytic activity and can introduce nicks or breaks into double-stranded DNA (in vitro). May play a role in DNA repair. Its transcriptional activity on the multidrug resistance gene MDR1 is enhanced in presence of the APEX1 acetylated form at 'Lys-6' and 'Lys-7'. Binds preferentially to 5'-[CU]CUGCG-3' motif in vitro. The secreted form acts as an extracellular mitogen and stimulates cell migration and proliferation.
products references :
Absence of MHC expression in lens and cloning of dbpB/YB-1, a DNA-binding protein expressed in mouse lens.Shaughnessy M., Wistow G.J.Curr. Eye Res. 11:171-181(1992)
The Y-box factors
a family of nucleic acid binding proteins conserved from Escherichia coli to man.Familari M., Sak D., Wolffe A.P., Tafuri S.R., Ranjan M.New Biol. 4:290-298(1992)
Unusual DNA binding characteristics of an in vitro translation product of the CCAAT binding protein mYB-1.Gai X., Lipson K.E., Prystowsky M.B.Nucleic Acids Res. 20:601-606(1992)
A mouse Y box protein, MSY1, is associated with paternal mRNA in spermatocytes.Tafuri S.R., Familari M., Wolffe A.P.J. Biol. Chem. 268:12213-12220(1993)
Molecular interactions between single-stranded DNA-binding proteins associated with an essential MCAT element in the mouse smooth muscle alpha-actin promoter.Kelm R.J. Jr., Cogan J.G., Elder P.K., Strauch A.R., Getz M.J.J. Biol. Chem. 274:14238-14245(1999)
Phosphoproteomic analysis of the developing mouse brain.Ballif B.A., Villen J., Beausoleil S.A., Schwartz D., Gygi S.P.Mol. Cell. Proteomics 3:1093-1101(2004)
Large-scale phosphorylation analysis of mouse liver.Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P.Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007)
Three proteins of the U7-specific Sm ring function as the molecular ruler to determine the site of 3'-end processing in mammalian histone pre-mRNA.Yang X.-C., Torres M.P., Marzluff W.F., Dominski Z.Mol. Cell. Biol. 29:4045-4056(2009)
Large scale localization of protein phosphorylation by use of electron capture dissociation mass spectrometry.Sweet S.M., Bailey C.M., Cunningham D.L., Heath J.K., Cooper H.J.Mol. Cell. Proteomics 8:904-912(2009)
ncbi acc num :
NP_035862.2
ncbi gb acc num :
NM_011732.2
ncbi pathways :
Gene Expression Pathway (1323801); IL-2 Signaling Pathway (198331); Processing Of Capped Intron-Containing Pre-mRNA Pathway (1323840); SIDS Susceptibility Pathways (198328); MRNA Splicing Pathway (1323841); MRNA Splicing - Major Pathway (1323842); MRNA Splicing - Minor Pathway (1323843); MRNA Processing Pathway (198369)
uniprot summary :
YB-1: a nuclear protein that binds to splice sites in pre-mRNA and regulates splice site selection. Binds and stabilizes cytoplasmic mRNA. Contributes to the regulation of translation by modulating the interaction between the mRNA and eukaryotic initiation factors CCAAT-containing Y-box of HLA class II genes. Component of cytoplasmic messenger ribonucleoprotein particles (mRNPs). Interacts with AKT1, SFRS9, THOC4, MSH2, XRCC5, WRN and NCL. Can bind to DNA as a homomeric form, (EFI-A)n or as a heteromeric form in association with EFI-B. Homodimer in the presence of ATP. Involved in cisplatin resistance. Seems to be a negative regulatory factor. May play a role in both transcriptional and translational regulation of spermatogenesis. Found at very low levels at day 10 and levels increase at day 15 and persist throughout adulthood. Protein type: RNA splicing; Transcription factor; RNA processing; RNA-binding. Cellular Component: cytoplasm; dendrite; extracellular region; intracellular membrane-bound organelle; nuclear membrane; nucleus; perinuclear region of cytoplasm; ribonucleoprotein complex; stress granule; U12-dependent spliceosome. Molecular Function: chromatin binding; DNA binding; GTPase binding; mRNA binding; nucleic acid binding; p53 binding; protein binding; RNA binding; sequence-specific DNA binding; single-stranded DNA binding; transcription factor binding. Biological Process: in utero embryonic development; mRNA processing; negative regulation of apoptosis; negative regulation of insulin receptor signaling pathway; negative regulation of striated muscle cell differentiation; negative regulation of transcription from RNA polymerase II promoter; positive regulation of cell division; positive regulation of cell proliferation; positive regulation of transcription from RNA polymerase II promoter; regulation of transcription, DNA-dependent; RNA splicing; transcription, DNA-dependent