protein

Recombinant Human Cyclic AMP-dependent transcription factor ATF-6 alpha (ATF6)

MBS967664

INQUIRE

INQUIRE

Recombinant Protein

Recombinant Human Cyclic AMP-dependent transcription factor ATF-6 alpha (ATF6)

Cyclic AMP-dependent transcription factor ATF-6 alpha (ATF6)

Cyclic AMP-dependent transcription factor ATF-6 alpha; cAMP-dependent transcription factor ATF-6 alpha; Activating transcription factor 6 alpha; ATF6-alphaCleaved into the following chain:; 1. Processed cyclic AMP-dependent transcription factor ATF-6 alph

cyclic AMP-dependent transcription factor ATF-6 alpha; Cyclic AMP-dependent transcription factor ATF-6 alpha; cyclic AMP-dependent transcription factor ATF-6 alpha; cAMP-dependent transcription factor ATF-6 alpha; activating transcription factor 6; Activating transcription factor 6 alpha; ATF6-alpha

ATF6

ATF6; ATF6; ATF6A; cAMP-dependent transcription factor ATF-6 alpha; ATF6-alpha

ATF6A_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

1-377; Provide the complete intracellular domain.

377

MGEPAGVAGTMESPFSPGLFHRLDEDWDSALFAELGYFT
DTDELQLEAANETYENNFDNLDFDLDLMPWESDIWDINN
QICTVKDIKAEPQPLSPASSSYSVSSPRSVDSYSSTQHV
PEELDLSSSSQMSPLSLYGENSNSLSSAEPLKEDKPVTG
PRNKTENGLTPKKKIQVNSKPSIQPKPLLLPAAPKTQTN
SSVPAKTIIIQTVPTLMPLAKQQPIISLQPAPTKGQTVL
LSQPTVVQLQAPGVLPSAQPVLAVAGGVTQLPNHVVNVV
PAPSANSPVNGKLSVTKPVLQSTMRNVGSDIAVLRRQQR
MIKNRESACQSRKKKKEYMLGLEARLKAALSENEQLKKE
NGTLKRQLDEVVSENQRLKVPSPKRR

>90%

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Species: Homo sapiens (Human)

ATF6

56786157

NP_031374.2

NM_007348.3

P18850

74,585 Da

Activation Of Chaperone Genes By ATF6-alpha Pathway (530770); Activation Of Chaperones By ATF6-alpha Pathway (105905); Activation Of Genes By ATF4 Pathway (530772); Alzheimer's Disease Pathway (83097); Alzheimer's Disease Pathway (509); Alzheimers Disease Pathway (672448); Metabolism Of Proteins Pathway (106230); PERK Regulated Gene Expression Pathway (105907); Protein Processing In Endoplasmic Reticulum Pathway (167325); Protein Processing In Endoplasmic Reticulum Pathway (167190)

This gene encodes a transcription factor that activates target genes for the unfolded protein response (UPR) during endoplasmic reticulum (ER) stress. Although it is a transcription factor, this protein is unusual in that it is synthesized as a transmembrane protein that is embedded in the ER. It functions as an ER stress sensor/transducer, and following ER stress-induced proteolysis, it functions as a nuclear transcription factor via a cis-acting ER stress response element (ERSE) that is present in the promoters of genes encoding ER chaperones. This protein has been identified as a survival factor for quiescent but not proliferative squamous carcinoma cells. There have been conflicting reports about the association of polymorphisms in this gene with diabetes in different populations, but another polymorphism has been associated with increased plasma cholesterol levels. This gene is also thought to be a potential therapeutic target for cystic fibrosis. [provided by RefSeq, Aug 2011]

ATF6A: Transcription factor that acts during endoplasmic reticulum stress by activating unfolded protein response target genes. Binds DNA on the 5 -CCAC[GA]-3 half of the ER stress response element (ERSE) (5 -CCAAT-N(9)-CCAC[GA]-3 ) and of ERSE II (5 -ATTGG-N-CCACG-3 ). Binding to ERSE requires binding of NF-Y to ERSE. Could also be involved in activation of transcription by the serum response factor. Belongs to the bZIP family. ATF subfamily. Protein type: Membrane protein, integral; Transcription factor. Chromosomal Location of Human Ortholog: 1q23.3. Cellular Component: nucleoplasm; Golgi membrane; Golgi apparatus; endoplasmic reticulum membrane; membrane; endoplasmic reticulum; integral to endoplasmic reticulum membrane; nuclear envelope; nucleus. Molecular Function: protein binding; protein heterodimerization activity; transcription coactivator activity; transcription factor activity. Biological Process: regulation of transcription from RNA polymerase II promoter; unfolded protein response, activation of signaling protein activity; cellular protein metabolic process; protein folding; transcription, DNA-dependent; unfolded protein response; positive regulation of transcription of target genes involved in unfolded protein response; response to stress; signal transduction. Disease: Achromatopsia 7

INQUIRE

INQUIRE