catalog number :
MBS967514
products type :
Recombinant Protein
products full name :
Recombinant Human Ornithine decarboxylase (ODC1)
products short name :
[Ornithine decarboxylase (ODC1)]
products name syn :
[Ornithine decarboxylase; ODC; EC=4.1.1.17]
other names :
[ornithine decarboxylase isoform 1; Ornithine decarboxylase; ornithine decarboxylase; ornithine decarboxylase 1]
products gene name :
[ODC1]
other gene names :
[ODC1; ODC1; ODC; ODC]
uniprot entry name :
DCOR_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[1-461aa; Full Length]
sequence :
MNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDA
FYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSKAIVK
TLAATGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQV
SQIKYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIA
TDDSKAVCRLSVKFGATLRTSRLLLERAKELNIDVVGVS
FHVGSGCTDPETFVQAISDARCVFDMGAEVGFSMYLLDI
GGGFPGSEDVKLKFEEITGVINPALDKYFPSDSGVRIIA
EPGRYYVASAFTLAVNIIAKKIVLKEQTGSDDEDESSEQ
TFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDEKYY
SSSIWGPTCDGLDRIVERCDLPEMHVGDWMLFENMGAYT
VAAASTFNGFQRPTIYYVMSGPAWQLMQQFQNPDFPPEV
EEQDASTLPVSCAWESGMKRHRAACASASINV
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
image1 heading :
SDS-Page
other info1 :
Species: Homo sapiens (Human)
other info2 :
Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
products categories :
Signal Transduction
products description :
Key enzyme of polyamine biosynthesis that converts ornithine into putrescine, which is the precursor for the polyamines, spermidine and spermine.
ncbi acc num :
NP_001274118.1
ncbi gb acc num :
NM_001287189.1
ncbi mol weight :
51,148 Da
ncbi pathways :
Arginine And Proline Metabolism Pathway (82957); Arginine And Proline Metabolism Pathway (323); Glutathione Metabolism Pathway (82973); Glutathione Metabolism Pathway (343); Metabolic Pathways (132956); Metabolism Pathway (477135); Metabolism Of Amino Acids And Derivatives Pathway (106169); Metabolism Of Polyamines Pathway (106193); Polyamine Biosynthesis, Arginine = Ornithine = Putrescine Pathway (413403); Polyamine Biosynthesis, Arginine = Ornithine = Putrescine Pathway (468321)
ncbi summary :
This gene encodes the rate-limiting enzyme of the polyamine biosynthesis pathway which catalyzes ornithine to putrescine. The activity level for the enzyme varies in response to growth-promoting stimuli and exhibits a high turnover rate in comparison to other mammalian proteins. Originally localized to both chromosomes 2 and 7, the gene encoding this enzyme has been determined to be located on 2p25, with a pseudogene located on 7q31-qter. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Dec 2013]
uniprot summary :
ODC: the rate-limiting enzyme of the polyamine biosynthesis pathway which catalyzes ornithine to putrescine. The activity level for the enzyme varies in response to growth-promoting stimuli and exhibits a high turnover rate in comparison to other mammalian proteins. Originally localized to both chromosomes 2 and 7, the gene encoding this enzyme has been determined to be located on 2p25, with a pseudogene located on 7q31-qter. [provided by RefSeq, Jul 2008]. Protein type: Amino Acid Metabolism - arginine and proline; Lyase; Other Amino Acids Metabolism - glutathione; Cell cycle regulation; EC 4.1.1.17. Chromosomal Location of Human Ortholog: 2p25. Cellular Component: cytoplasm; cytosol. Molecular Function: protein homodimerization activity; ornithine decarboxylase activity. Biological Process: response to virus; positive regulation of cell proliferation; regulation of protein catabolic process; kidney development; regulation of amino acid metabolic process; putrescine biosynthetic process from ornithine; polyamine metabolic process. Disease: Colorectal Cancer