Recombinant Mouse Transcriptional repressor CTCFL | MyBioSource MBS967458 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Mouse Transcriptional repressor CTCFL

catalog :

MBS967458

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS967458

products type :

Recombinant Protein

products full name :

Recombinant Mouse Transcriptional repressor CTCFL

products short name :

Transcriptional repressor CTCFL

products name syn :

Brother of the regulator of imprinted sites; CCCTC-binding factor; CTCF paralog; CTCF-like protein

other names :

transcriptional repressor CTCFL; Transcriptional repressor CTCFL; transcriptional repressor CTCFL; CCCTC-binding factor (zinc finger protein)-like; Brother of the regulator of imprinted sites; CCCTC-binding factor; CTCF paralog; CTCF-like protein

products gene name :

Ctcfl

other gene names :

Ctcfl; Ctcfl; Boris; OTTMUSG00000016680; Boris

uniprot entry name :

CTCFL_MOUSE

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

1-636

sequence length :

636

sequence :

MAAAEVPVPSGYFTQIKEQKLKPGDLEEEKEEDGVQRVE
AQEGVVKEVEAENSCLLLEARAPVESDRRILTLQTVHLE
SQDVHLQGLGWLSVPHSEELSGTVPEAEGILQLPSVLWL
DPEPQLSLQHCVTVSIPEELYPPEELQRIHFHLLRENVL
MAEENPELTPDLDESTALKKPEEDEKDQLPPQGETDKRE
ERLLLLEMKPKEGKDDEIVLTISHLSLEEQQDPPAANQT
SVPGAKAAKPKRRRQTKGKPQ

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products description :

Testis-specific DNA binding protein responsible for insulator function, nuclear architecture and transcriptional control, which probably acts by recruiting epigenetic chromatin modifiers. Plays a key role in gene imprinting in male germline, by participating in the establishment of differential methylation at the IGF2/H19 imprinted control region (ICR). Directly binds the unmethylated H19 ICR and recruits the PRMT7 methyltransferase, leading to methylate histone H4 'Arg-3' to form H4R3sme2. This probably leads to recruit de novo DNA methyltransferases at these sites. Ses to act as tumor suppressor. In association with DNMT1 and DNMT3B, involved in activation of BAG1 gene expression by binding to its promoter. Required for dimethylation of H3 lysine 4 (H3K4me2) of MYC and BRCA1 promoters.

products references :

BORIS, a novel male germ-line-specific protein associated with epigenetic reprogramming events, shares the same 11-zinc-finger domain with CTCF, the insulator protein involved in reading imprinting marks in the soma.Loukinov D.I., Pugacheva E., Vatolin S., Pack S.D., Moon H., Chernukhin I., Mannan P., Larsson E., Kanduri C., Vostrov A.A., Cui H., Niemitz E.L., Rasko J.E.J., Docquier F.M., Kistler M., Breen J.J., Zhuang Z., Quitschke W.W., Renkawitz R., Klenova E.M., Feinberg A.P., Ohlsson R., Morse H.C. III, Lobanenkov V.V.Proc. Natl. Acad. Sci. U.S.A. 99:6806-6811(2002) Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) The testis-specific factor CTCFL cooperates with the protein methyltransferase PRMT7 in H19 imprinting control region methylation.Jelinic P., Stehle J.-C., Shaw P.PLoS Biol. 4:E355-E355(2006)

ncbi gi num :

124487069

ncbi acc num :

NP_001074856.1

ncbi gb acc num :

NM_001081387.2

uniprot acc num :

A2APF3

ncbi mol weight :

89.06kD

uniprot summary :

BORIS: Testis-specific DNA binding protein responsible for insulator function, nuclear architecture and transcriptional control, which probably acts by recruiting epigenetic chromatin modifiers. Plays a key role in gene imprinting in male germline, by participating in the establishment of differential methylation at the IGF2/H19 imprinted control region (ICR). Directly binds the unmethylated H19 ICR and recruits the PRMT7 methyltransferase, leading to methylate histone H4 'Arg-3' to form H4R3sme2. This probably leads to recruit de novo DNA methyltransferases at these sites. Seems to act as tumor suppressor. In association with DNMT1 and DNMT3B, involved in activation of BAG1 gene expression by binding to its promoter. Required for dimethylation of H3 lysine 4 (H3K4me2) of MYC and BRCA1 promoters. Interacts with histones, PRMT7 and SETD1A. Interacts (via N-terminus) with BAG6/BAT3. Testis specific. Specifically expressed in primary spermatocytes. Belongs to the CTCF zinc-finger protein family. Protein type: Cancer Testis Antigen (CTA); C2H2-type zinc finger protein; DNA-binding. Cellular Component: cytoplasm; nucleus. Molecular Function: DNA binding; histone binding; metal ion binding; nucleic acid binding; protein binding; sequence-specific DNA binding. Biological Process: chromatin modification; DNA methylation during gametogenesis; genetic imprinting; histone methylation; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; regulation of histone H3-K4 methylation; regulation of transcription, DNA-dependent; transcription from RNA polymerase II promoter; transcription, DNA-dependent

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.05 mg (Yeast)

price2 :

190

size3 :

0.2 mg (E-Coli)

price3 :

460

size4 :

0.2 mg (Yeast)

price4 :

460

size5 :

0.5 mg (Yeast)

price5 :

750

more info or order :

MyBioSource product webpage