protein

Recombinant Human Prohibitin

MBS967237

0.05 mg (E-Coli)

190 USD

Recombinant Protein

Recombinant Human Prohibitin

Prohibitin

prohibitin isoform 1; Prohibitin; prohibitin; prohibitin

PHB

PHB; PHB; PHB1; HEL-215; HEL-S-54e

PHB_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

1-272

QKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEIL KSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVA QQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQL SRSRNITYLPAGQSVLLQLPQ
MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIF
DRFRGVQDIVVGEGTHFLIPWV

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Transcription

Prohibitin inhibits DNA synthesis. It has a role in regulating proliferation. As yet it is unclear if the protein or the mRNA exhibits this effect. May play a role in regulating mitochondrial respiration activity and in aging.

The human prohibitin gene located on chromosome 17q21 is mutated in sporadic breast cancer.Sato T., Saito H., Swensen J., Olifant A., Wood C., Danner D., Sakamoto T., Takita K., Kasumi F., Miki Y., Skolnick M., Nakamura Y.Cancer Res. 52:1643-1646(1992)

527498279

NP_001268425.1

NM_001281496.1

P35232

33.9kD

ARMS-mediated Activation Pathway (1269471); Axon Guidance Pathway (1270303); Cytokine Signaling In Immune System Pathway (1269310); DAP12 Interactions Pathway (1269283); DAP12 Signaling Pathway (1269284); Developmental Biology Pathway (1270302); Downstream Signal Transduction Pathway (1269479); Downstream Signaling Of Activated FGFR1 Pathway (1269392); Downstream Signaling Of Activated FGFR2 Pathway (1269403); Downstream Signaling Of Activated FGFR3 Pathway (1269413)

This gene is evolutionarily conserved, and its product is proposed to play a role in human cellular senescence and tumor suppression. Antiproliferative activity is reported to be localized to the 3' UTR, which is proposed to function as a trans-acting regulatory RNA. Several pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]

PHB: a pleiotropic membrane protein that suppresses cell proliferation, apoptosis and senescence. It plays a role both in maintaining mitochondrial integrity and in cell cycle regulation. Expression increases approximately 3-fold upon entry into G1 phase compared with other phases of the cell cycle. It helps prevent ROS-induced senescence and its expression decreases heterogeneously during cellular aging. Helps maintain the angiogenic capacity of endothelial cells. Up-regulated during activation of primary human T cells via CD3/CD28 pathways. Present in multiple cellular compartments. Large assemblies of PHB and PHB2 localize in the inner membrane of mitochondria. Acts as a mitochondrial chaperone protein, regulates mitochondrial morphogenesis, and helps regulate the organization of mitochondrial DNA. Reported to target lipid rafts. In the nucleus, it has been reported to interact with various transcription factors, modulating their activity. A potential tumor suppressor that functions as a potent transcriptional corepressor for estrogen receptor alpha. It is downregulated by androgens, and represses androgen receptor activity. Co-localizes with Rb in the nucleus and recruits N-CoR and HDAC1 for transcriptional repression. In vivo promoter occupancy studies have suggested that the PHB gene is a direct target of c-Myc. May bind to and enhance the transcriptional activity of p53. Both Phb and Phb2 are present in the circulation and can be internalized by cultured cells. Overexpressed in endometrioid ovarian adenocarcinoma and papillary serous ovarian carcinoma. Mutated in sporadic breast cancer. Protein type: Nuclear receptor co-regulator; Cell cycle regulation; Transcription, coactivator/corepressor; Mitochondrial; Motility/polarity/chemotaxis; Chaperone; Oncoprotein; Apoptosis. Chromosomal Location of Human Ortholog: 17q21. Cellular Component: cell surface; cytoplasm; early endosome; integral to plasma membrane; membrane; mitochondrial inner membrane; mitochondrion; myelin sheath; nucleoplasm; nucleus; plasma membrane. Molecular Function: complement component C3a binding; complement component C3b binding; enzyme binding; histone deacetylase binding; protein binding; protein C-terminus binding; proteinase activated receptor binding. Biological Process: histone deacetylation; mitochondrion organization and biogenesis; negative regulation of cell growth; negative regulation of cell proliferation; negative regulation of protein catabolic process; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; osteoblast differentiation; positive regulation of complement activation; positive regulation of G-protein coupled receptor protein signaling pathway; positive regulation of transcription, DNA-dependent; progesterone receptor signaling pathway; protein stabilization; regulation of apoptosis; regulation of transcription, DNA-dependent; signal transduction. Disease: Breast Cancer

0.05 mg (E-Coli)

190 USD

0.2 mg (E-Coli)

460

0.5 mg (E-Coli)

750

0.05 mg (Baculovirus)

950

0.05 mg (Mammalian-Cell)

1170