Recombinant Human 14-3-3 protein sigma | MyBioSource MBS967183 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human 14-3-3 protein sigma

catalog :

MBS967183

quantity :

0.05 mg (E-Coli)

price :

175 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS967183

products type :

Recombinant Protein

products full name :

Recombinant Human 14-3-3 protein sigma

products short name :

14-3-3 protein sigma

products name syn :

Epithelial cell marker protein 1; Stratifin

other names :

14-3-3 protein sigma; 14-3-3 protein sigma; 14-3-3 protein sigma; stratifin; Epithelial cell marker protein 1; Stratifin

products gene name :

SFN

other gene names :

SFN; SFN; YWHAS; HME1

uniprot entry name :

1433S_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

1-248

sequence length :

248

sequence :

MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCE
ERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKG
PEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESR
VFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMD
ISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAK
TTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADN
AGEEGGEAPQEPQS

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Neuroscience

products description :

Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. When bound to KRT17, regulates protein synthesis and epithelial cell growth by stimulating Akt/mTOR pathway. May also regulate MDM2 autoubiquitination and degradation and thereby activate p53/TP53.

products references :

Complementary DNA cloning of a novel epithelial cell marker protein, HME1, that may be down-regulated in neoplastic mammary cells.Prasad G.L., Valverius E.M., McDuffie E., Cooper H.L.Cell Growth Differ. 3:507-513(1992) Molecular cloning and expression of the transformation sensitive epithelial marker stratifin. A member of a protein family that has been involved in the protein kinase C signalling pathway.Leffers H., Madsen P., Rasmussen H.H., Honore B., Andersen A.H., Walbum E., Vandekerckhove J., Celis J.E.J. Mol. Biol. 231:982-998(1993) 14-3-3 sigma is a p53-regulated inhibitor of G2/M progression.Hermeking H., Lengauer C., Polyak K., He T.-C., Zhang L., Thiagalingam S., Kinzler K.W., Vogelstein B.Mol. Cell 1:3-11(1997) Microsequences of 145 proteins recorded in the two-dimensional gel protein database of normal human epidermal keratinocytes.Rasmussen H.H., van Damme J., Puype M., Gesser B., Celis J.E., Vandekerckhove J.Electrophoresis 13:960-969(1992) Exportin 7 defines a novel general nuclear export pathway.Mingot J.-M., Bohnsack M.T., Jaekle U., Goerlich D.EMBO J. 23:3227-3236(2004) A probability-based approach for high-throughput protein phosphorylation analysis and site localization.Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.Nat. Biotechnol. 24:1285-1292(2006) CARPs enhance p53 turnover by degrading 14-3-3sigma and stabilizing MDM2.Yang W., Dicker D.T., Chen J., El-Deiry W.S.Cell Cycle 7:670-682(2008) Phosphorylation-dependent binding of 14-3-3 terminates signalling by the Gab2 docking protein.Brummer T., Larance M., Herrera Abreu M.T., Lyons R.J., Timpson P., Emmerich C.H., Fleuren E.D.G., Lehrbach G.M., Schramek D., Guilhaus M., James D.E., Daly R.J.EMBO J. 27:2305-2316(2008) Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.Mol. Cell 31:438-448(2008) A quantitative atlas of mitotic phosphorylation.Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) Interaction of Akt-phosphorylated SRPK2 with 14-3-3 mediates cell cycle and cell death in neurons.Jang S.W., Liu X., Fu H., Rees H., Yepes M., Levey A., Ye K.J. Biol. Chem. 284:24512-24525(2009) Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.Sci. Signal. 3:RA3-RA3(2010) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) COP9 signalosome subunit 6 stabilizes COP1, which functions as an E3 ubiquitin ligase for 14-3-3sigma.Choi H.H., Gully C., Su C.H., Velazquez-Torres G., Chou P.C., Tseng C., Zhao R., Phan L., Shaiken T., Chen J., Yeung S.C., Lee M.H.Oncogene 30:4791-4801(2011) A structural basis for 14-3-3sigma functional specificity.Wilker E.W., Grant R.A., Artim S.C., Yaffe M.B.J. Biol. Chem. 280:18891-18898(2005) Identification and structural characterization of two 14-3-3 binding sites in the human peptidylarginine deiminase type VI.Rose R., Rose M., Ottmann C.J. Struct. Biol. 180:65-72(2012)

ncbi gi num :

5454052

ncbi acc num :

NP_006133.1

ncbi gb acc num :

NM_006142.3

uniprot acc num :

P31947

ncbi mol weight :

55.2kD

ncbi pathways :

Activation Of BAD And Translocation To Mitochondria Pathway (1270271); Activation Of BH3-only Proteins Pathway (1270270); Aldosterone-regulated Sodium Reabsorption Pathway (130626); Aldosterone-regulated Sodium Reabsorption Pathway (130590); Alpha6-Beta4 Integrin Signaling Pathway (198807); Apoptosis Pathway (1270262); Calcium Regulation In The Cardiac Cell Pathway (198906); Cell Cycle Pathway (1269741); Cell Cycle Checkpoints Pathway (1269742); Cell Cycle Pathway (83054)

uniprot summary :

14-3-3 sigma: Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. When bound to KRT17, regulates protein synthesis and epithelial cell growth by stimulating Akt/mTOR pathway. Homodimer. Interacts with KRT17 and SAMSN1. Found in a complex with XPO7, EIF4A1, ARHGAP1, VPS26A, VPS29, VPS35 and SFN. Interacts with GAB2. Interacts with SRPK2. Present mainly in tissues enriched in stratified squamous keratinizing epithelium. Belongs to the 14-3-3 family. 2 isoforms of the human protein are produced by alternative splicing. Protein type: Adaptor/scaffold. Chromosomal Location of Human Ortholog: 1p36.11. Cellular Component: cytoplasm; cytoplasmic vesicle membrane; cytosol; extracellular space; mitochondrion; nucleus. Molecular Function: phosphoprotein binding; protein binding; protein domain specific binding; protein kinase binding; protein kinase C inhibitor activity. Biological Process: apoptosis; DNA damage response, signal transduction resulting in induction of apoptosis; gene expression; keratinization; negative regulation of caspase activity; negative regulation of protein kinase activity; positive regulation of cell growth; positive regulation of epidermal cell differentiation; positive regulation of protein export from nucleus; programmed cell death; regulation of cyclin-dependent protein kinase activity; regulation of epidermal cell division; release of cytochrome c from mitochondria; signal transduction; small GTPase mediated signal transduction; transcription initiation from RNA polymerase II promoter

size1 :

0.05 mg (E-Coli)

price1 :

175 USD

size2 :

0.2 mg (E-Coli)

price2 :

295

size3 :

0.5 mg (E-Coli)

price3 :

580

size4 :

1 mg (E-Coli)

price4 :

855

size5 :

0.05 mg (Baculovirus)

price5 :

995

more info or order :

MyBioSource product webpage