Recombinant Human Osteocalcin | MyBioSource MBS967148 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Osteocalcin

catalog :

MBS967148

quantity :

0.05 mg (E-Coli)

price :

180 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS967148

products type :

Recombinant Protein

products full name :

Recombinant Human Osteocalcin

products short name :

Osteocalcin

products name syn :

Bone Gla protein; BGP; Gamma-carboxyglutamic acid-containing protein

other names :

osteocalcin preproprotein; Osteocalcin; osteocalcin; bone gamma-carboxyglutamate (gla) protein; Bone Gla protein; BGP; Gamma-carboxyglutamic acid-containing protein

products gene name :

BGLAP

other gene names :

BGLAP; BGLAP; OC; BGP; OCN; BGP

uniprot entry name :

OSTCN_HUMAN

host :

E Coli

sequence positions :

52-100

sequence length :

100

sequence :

YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQ
EAYRRFYGPV

purity :

Greater than 90% as determined by SDS-PAGE.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Metabolism

products description :

Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.

products references :

The cDNA and derived amino acid sequences of human and bovine bone Gla protein.Kiefer M.C., Saphire A.C.S., Bauer D.M., Barr P.J.Nucleic Acids Res. 18:1909-1909(1990) Isolation of the human gene for bone gla protein utilizing mouse and rat cDNA clones.Celeste A.J., Buecker J.L., Kriz R., Wang E.A., Wozney J.M.EMBO J. 5:1885-1890(1986) SeattleSNPs variation discovery resourceThe DNA sequence and biological annotation of human chromosome 1.Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K., Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.Nature 441:315-321(2006)

ncbi gi num :

40316933

ncbi acc num :

NP_954642.1

ncbi gb acc num :

NM_199173.5

uniprot acc num :

P02818

ncbi mol weight :

33.2kD

ncbi pathways :

FGF Signaling Pathway (137989); Gamma Carboxylation, Hypusine Formation And Arylsulfatase Activation Pathway (1268702); Gamma-carboxylation Of Protein Precursors Pathway (1268704); Gamma-carboxylation, Transport, And Amino-terminal Cleavage Of Proteins Pathway (1268703); Glucocorticoid Receptor Regulatory Network Pathway (138014); Interleukin-11 Signaling Pathway (698753); Metabolism Of Proteins Pathway (1268677); Notch-mediated HES/HEY Network Pathway (169347); Post-translational Protein Modification Pathway (1268701); Regulation Of Retinoblastoma Protein Pathway (137916)

ncbi summary :

This gene encodes a highly abundant bone protein secreted by osteoblasts that regulates bone remodeling and energy metabolism. The encoded protein contains a Gla (gamma carboxyglutamate) domain, which functions in binding to calcium and hydroxyapatite, the mineral component of bone. Serum osteocalcin levels may be negatively correlated with metabolic syndrome. Read-through transcription exists between this gene and the neighboring upstream gene, PMF1 (polyamine-modulated factor 1), but the encoded protein only shows sequence identity with the upstream gene product. [provided by RefSeq, Jun 2015]

size1 :

0.05 mg (E-Coli)

price1 :

180 USD

size2 :

0.2 mg (E-Coli)

price2 :

410

size3 :

0.5 mg (E-Coli)

price3 :

665

size4 :

1 mg (E-Coli)

price4 :

1050

more info or order :

MyBioSource product webpage