product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse Complement C1q subcomponent subunit A
catalog :
MBS966734
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS966734
products type :
Recombinant Protein
products full name :
Recombinant Mouse Complement C1q subcomponent subunit A
products short name :
Complement C1q subcomponent subunit A
other names :
complement C1q subcomponent subunit A; Complement C1q subcomponent subunit A; complement C1q subcomponent subunit A; complement component 1, q subcomponent, alpha polypeptide
products gene name :
C1qa
other gene names :
C1qa; C1qa; C1q; AI255395
uniprot entry name :
C1QA_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
23-245
sequence length :
245
sequence :
EDVCRAPNGKDGAPGNPGRPGRPGLKGERGEPGAAGIRT
GIRGFKGDPGESGPPGKPGNVGLPGPSGPLGDSGPQGLK
GVKGNPGNIRDQPRPAFSAIRQNPMTLGNVVIFDKVLTN
QESPYQNHTGRFICAVPGFYYFNFQVISKWDLCLFIKSS
SGGQPRDSLSFSNTNNKGLFQVLAGGTVLQLRRGDEVWI
EKDPAKGRIYQGTEADSIFSGFLIFPSA
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complent system. The collagen-like regions of C1q interact with the Ca2+-dependent C1r2C1s2 proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
products references :
Gene expression of the A- and B-chain of mouse C1q in different tissues and the characterization of the recombinant A-chain.Petry F., Reid K.B.M., Loos M.J. Immunol. 147:3988-3993(1991) The mouse C1q genes are clustered on chromosome 4 and show conservation of gene organization.Petry F., McClive P.J., Botto M., Morley B.J., Morahan G., Loos M.Immunogenetics 43:370-376(1996) Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C. Proteome-wide characterization of N-glycosylation events by diagonal chromatography.Ghesquiere B., Van Damme J., Martens L., Vandekerckhove J., Gevaert K.J. Proteome Res. 5:2438-2447(2006)
ncbi gi num :
124286805
ncbi acc num :
NP_031598.2
ncbi gb acc num :
NM_007572.2
uniprot acc num :
P98086
ncbi mol weight :
39.5kD
ncbi pathways :
Allograft Rejection Pathway (920963); Chagas Disease (American Trypanosomiasis) Pathway (147810); Chagas Disease (American Trypanosomiasis) Pathway (147795); Classical Antibody-mediated Complement Activation Pathway (1323711); Complement Activation, Classical Pathway (198379); Complement And Coagulation Cascades Pathway (198335); Complement And Coagulation Cascades Pathway (83270); Complement And Coagulation Cascades Pathway (484); Complement Cascade Pathway (1323708); Creation Of C4 And C2 Activators Pathway (1323710)
uniprot summary :
C1QA: C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2 )-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes. Protein type: Secreted; Secreted, signal peptide. Cellular Component: collagen; extracellular region. Molecular Function: protein binding. Biological Process: complement activation, classical pathway; immune system process; innate immune response
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.05 mg (Yeast)
price2 :
190
size3 :
0.2 mg (E-Coli)
price3 :
460
size4 :
0.2 mg (Yeast)
price4 :
460
size5 :
0.5 mg (Yeast)
price5 :
750
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!