product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Macaca mulatta (Rhesus macaque) Interleukin-1 alpha (IL1A)
catalog :
MBS966605
quantity :
1 mg (E-Coli)
price :
1280 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS966605
products type :
Recombinant Protein
products full name :
Recombinant Macaca mulatta (Rhesus macaque) Interleukin-1 alpha (IL1A)
products short name :
(Rhesus macaque) Interleukin-1 alpha (IL1A)
products name syn :
Recombinant (Rhesus macaque) Interleukin-1 alpha (IL1A); Interleukin-1 alpha; IL-1 alpha; Hematopoietin-1
other names :
interleukin-1 alpha; Interleukin-1 alpha; interleukin-1 alpha; IL-1 alpha; hematopoietin-1; Hematopoietin-1
products gene name syn :
IL1A
other gene names :
IL1A; IL1A; IL-1 alpha
uniprot entry name :
IL1A_MACMU
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
113-271
sequence length :
271
sequence :
SAPFSFLSNMTYHFIRIIKHEFILNDTLNQTIIRANDQH
LTAAAIHNLDEAVKFDMGAYTSSKDDTKVPVILRISKTQ
LYVSAQDEDQPVLLKEMPEINKTITGSETNFLFFWETHG
TKNYFISVAHPNLFIATKHDNWVCLAKGLPSITDFQILE
NQA
purity :
>90%(SDS-PAGE)
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
other info1 :
Species: Macaca mulatta (Rhesus macaque)
products description :
Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
ncbi gi num :
112363113
ncbi acc num :
NP_001036222.1
ncbi gb acc num :
NM_001042757.1
uniprot acc num :
P48089
ncbi mol weight :
19kD
ncbi pathways :
Apoptosis Pathway (86730); Apoptosis Pathway (470); Cytokine-cytokine Receptor Interaction Pathway (86721); Cytokine-cytokine Receptor Interaction Pathway (460); Graft-versus-host Disease Pathway (86790); Graft-versus-host Disease Pathway (536); Hematopoietic Cell Lineage Pathway (86748); Hematopoietic Cell Lineage Pathway (489); Influenza A Pathway (217176); Influenza A Pathway (217150)
uniprot summary :
Function: Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells. Subunit structure: Monomer. Subcellular location: Secreted. Note: The lack of a specific hydrophobic segment in the precursor sequence suggests that IL-1 is released by damaged cells or is secreted by a mechanism differing from that used for other secretory proteins. Domain: The similarity among the IL-1 precursors suggests that the amino ends of these proteins serve some as yet undefined function. Sequence similarities: Belongs to the IL-1 family.
size1 :
1 mg (E-Coli)
price1 :
1280 USD
size2 :
1 mg (Yeast)
price2 :
1740
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!