catalog number :
MBS966376
products type :
Recombinant Protein
products full name :
Recombinant Rat 3-oxo-5-alpha-steroid 4-dehydrogenase 1 (Srd5a1)
products short name :
3-oxo-5-alpha-steroid 4-dehydrogenase 1 (Srd5a1)
products name syn :
Recombinant 3-oxo-5-alpha-steroid 4-dehydrogenase 1 (Srd5a1); 3-oxo-5-alpha-steroid 4-dehydrogenase 1 EC= 1.3.99.5; SR type 1 Steroid 5-alpha-reductase 1; S5AR 1
other names :
3-oxo-5-alpha-steroid 4-dehydrogenase 1; 3-oxo-5-alpha-steroid 4-dehydrogenase 1; 3-oxo-5-alpha-steroid 4-dehydrogenase 1; SR type 1; steroid 5 alpha-reductase 1; steroid 5-alpha-reductase 1; steroid-5-alpha-reductase 1; steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1); SR type 1; Steroid 5-alpha-reductase 1
products gene name syn :
Srd5a1
other gene names :
Srd5a1; Srd5a1; S5AR 1; S5AR 1
uniprot entry name :
S5A1_RAT
sequence positions :
1-259
sequence :
MVPLMELDELCLLDMLVYLEGFMAFVSIVGLRSVGSPYG
RYSPQWPGIRVPARPAWFIQELPSMAWPLYEYIRPAAAR
LGNLPNRVLLAMFLIHYVQRTLVFPVLIRGGKPTLLVTF
VLAFLFCTFNGYVQSRYLSQFAVYAEDWVTHPCFLTGFA
LWLVGMVINIHSDHILRNLRKPGETGYKIPRGGLFEYVS
AANYFGELVEWCGFALASWSLQGVVFALFTLSTLLTRAK
QHHQWYHEKFEDYPKSRKILIPFVL
form :
This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Tag Information: His tagged (Host tag may vary. Please inquire for specific tag information). Species: Rattus norvegicus (Rat)
other info2 :
Storage Buffer: PBS pH 7.4, 50% glycerol
ncbi acc num :
NP_058766.2
ncbi gb acc num :
NM_017070.3
ncbi mol weight :
29,780 Da
ncbi pathways :
Androgen Biosynthesis Pathway 649362!!Metabolism Pathway 649285!!Metabolism Of Lipids And Lipoproteins Pathway 649315!!Metabolism Of Steroid Hormones And Vitamins A And D Pathway 649358!!Steroid Hormone Biosynthesis Pathway 83333!!Steroid Hormone Biosynthesis Pathway 301
ncbi summary :
catalyzes the conversion of testosterone to dihydrotestosterone; required for male sex differentiation [RGD, Feb 2006]
uniprot summary :
Function: Converts testosterone into 5-alpha-dihydrotestosterone and progesterone or corticosterone into their corresponding 5-alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology. Catalytic activity: 5-alpha-pregnan-3,20-dione + NADP+ = progesterone + NADPH. Subcellular location: Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein . Potential. Tissue specificity: Liver and prostate (at a low level). Developmental stage: After the establishment of chromosomal sex at fertilization. Induction: Its expression is regulated by androgens such as testosterone. Sequence similarities: Belongs to the steroid 5-alpha reductase family. Biophysicochemical propertiespH dependence:Optimally active at alkaline pHs.
size :
1 mg (E Coli Derived)