product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Rat 3-oxo-5-alpha-steroid 4-dehydrogenase 1 (Srd5a1)
catalog :
MBS966376
quantity :
1 mg (E Coli Derived
price :
1510 USD
more info or order :
product information
catalog number :
MBS966376
products type :
Recombinant Protein
products full name :
Recombinant Rat 3-oxo-5-alpha-steroid 4-dehydrogenase 1 (Srd5a1)
products short name :
3-oxo-5-alpha-steroid 4-dehydrogenase 1 (Srd5a1)
products name syn :
Recombinant 3-oxo-5-alpha-steroid 4-dehydrogenase 1 (Srd5a1); 3-oxo-5-alpha-steroid 4-dehydrogenase 1 EC= 1.3.99.5; SR type 1 Steroid 5-alpha-reductase 1; S5AR 1
other names :
3-oxo-5-alpha-steroid 4-dehydrogenase 1; 3-oxo-5-alpha-steroid 4-dehydrogenase 1; 3-oxo-5-alpha-steroid 4-dehydrogenase 1; SR type 1; steroid 5 alpha-reductase 1; steroid 5-alpha-reductase 1; steroid-5-alpha-reductase 1; steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1); SR type 1; Steroid 5-alpha-reductase 1
products gene name syn :
Srd5a1
other gene names :
Srd5a1; Srd5a1; S5AR 1; S5AR 1
uniprot entry name :
S5A1_RAT
host :
E Coli or Yeast
sequence positions :
1-259
sequence length :
259
sequence :
MVPLMELDELCLLDMLVYLEGFMAFVSIVGLRSVGSPYG
RYSPQWPGIRVPARPAWFIQELPSMAWPLYEYIRPAAAR
LGNLPNRVLLAMFLIHYVQRTLVFPVLIRGGKPTLLVTF
VLAFLFCTFNGYVQSRYLSQFAVYAEDWVTHPCFLTGFA
LWLVGMVINIHSDHILRNLRKPGETGYKIPRGGLFEYVS
AANYFGELVEWCGFALASWSLQGVVFALFTLSTLLTRAK
QHHQWYHEKFEDYPKSRKILIPFVL
purity :
>90%
form :
This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Tag Information: His tagged (Host tag may vary. Please inquire for specific tag information). Species: Rattus norvegicus (Rat)
other info2 :
Storage Buffer: PBS pH 7.4, 50% glycerol
ncbi gi num :
77404421
ncbi acc num :
NP_058766.2
ncbi gb acc num :
NM_017070.3
uniprot acc num :
P24008
ncbi mol weight :
29,780 Da
ncbi pathways :
Androgen Biosynthesis Pathway 649362!!Metabolism Pathway 649285!!Metabolism Of Lipids And Lipoproteins Pathway 649315!!Metabolism Of Steroid Hormones And Vitamins A And D Pathway 649358!!Steroid Hormone Biosynthesis Pathway 83333!!Steroid Hormone Biosynthesis Pathway 301
ncbi summary :
catalyzes the conversion of testosterone to dihydrotestosterone; required for male sex differentiation [RGD, Feb 2006]
uniprot summary :
Function: Converts testosterone into 5-alpha-dihydrotestosterone and progesterone or corticosterone into their corresponding 5-alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology. Catalytic activity: 5-alpha-pregnan-3,20-dione + NADP+ = progesterone + NADPH. Subcellular location: Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein . Potential. Tissue specificity: Liver and prostate (at a low level). Developmental stage: After the establishment of chromosomal sex at fertilization. Induction: Its expression is regulated by androgens such as testosterone. Sequence similarities: Belongs to the steroid 5-alpha reductase family. Biophysicochemical propertiespH dependence:Optimally active at alkaline pHs.
size :
1 mg (E Coli Derived)
price :
1510 USD
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!