product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Putative protein SFTA3
catalog :
MBS966371
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
product information
catalog number :
MBS966371
products type :
Recombinant Protein
products full name :
Recombinant Human Putative protein SFTA3
products short name :
Putative protein SFTA3
products name syn :
Surfactant-associated protein H; SP-H
other names :
surfactant-associated protein 3; Surfactant-associated protein 3; surfactant-associated protein 3; surfactant associated 3; Surfactant-associated protein H; SP-H
products gene name :
SFTPH
other gene names :
SFTA3; SFTA3; SP-H; NANCI; SFTPH; SFTPH; SP-H
uniprot entry name :
SFTA3_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
Jan-94
sequence length :
94
sequence :
MRAGFSDFQLIRDQVLFLQDQAQRLTEWLQLSGFENPVS
ESTTLCLREREKRIPTCVAVCVPSPGTVHTALLHPTTLS
QSRSSSEAKMLIIHTA
ESTTLCLREREKRIPTCVAVCVPSPGTVHTALLHPTTLS
QSRSSSEAKMLIIHTA
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Cell Biology
products references :
The DNA sequence and analysis of human chromosome 14.Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H., Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.Nature 421:601-607(2003)
SFTA3, a novel protein of the lung
three-dimensional structure, characterisation and immune activation.Schicht M., Rausch F., Finotto S., Mathews M., Mattil A., Schubert M., Koch B., Traxdorf M., Bohr C., Worlitzsch D., Brandt W., Garreis F., Sel S., Paulsen F., Brauer L.Eur. Respir. J. 44:447-456(2014)
ncbi gi num :
157412273
ncbi acc num :
NP_001094811.1
ncbi gb acc num :
NM_001101341.1
uniprot acc num :
P0C7M3
ncbi mol weight :
14.6kD
ncbi pathways :
Defective CSF2RA Causes Pulmonary Surfactant Metabolism Dysfunction 4 (SMDP4) Pathway (1309214); Defective CSF2RB Causes Pulmonary Surfactant Metabolism Dysfunction 5 (SMDP5) Pathway (1309215); Disease Pathway (1268854); Diseases Associated With Surfactant Metabolism Pathway (1309208); Diseases Of Metabolism Pathway (1268939); Metabolism Of Proteins Pathway (1268677); Surfactant Metabolism Pathway (1309223)
uniprot summary :
SFTA3: Induced by lipopolysaccharides (LPS). Down-regulated by cytokines IL1B and IL23. {ECO:0000269 PubMed:24743970}. Chromosomal Location of Human Ortholog: 14q13.3. Cellular Component: clathrin-coated endocytic vesicle; endoplasmic reticulum membrane; extracellular region; lamellar body. Biological Process: cellular protein metabolic process
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.02 mg (Mammalian-Cell)
price2 :
335
size3 :
0.2 mg (E-Coli)
price3 :
460
size4 :
0.05 mg (Mammalian-Cell)
price4 :
635
size5 :
0.5 mg (E-Coli)
price5 :
750
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!