product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse Elongation factor 2
catalog :
MBS966309
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS966309
products type :
Recombinant Protein
products full name :
Recombinant Mouse Elongation factor 2
products short name :
Elongation factor 2
other names :
elongation factor 2; Elongation factor 2; elongation factor 2; eukaryotic translation elongation factor 2
products gene name :
Eef2
other gene names :
Eef2; Eef2; Ef-2; EF-2
uniprot entry name :
EF2_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
2-858
sequence length :
858
sequence :
VNFTVDQIRAIMDKKANIRNMSVIAHVDHGKSTLTDSLV
CKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLFY
ELSENDLNFIKQSKDGSGFLINLIDSPGHVDFSSEVTAA
LRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLMM
NKMDRALLELQLEPEELYQTFQRIVENVNVIISTYGEGE
SGPMGNIMIDPVLGTVGFGSGLHGWAFTLKQFAEMYVAK
FAAKGEGQLSAAERAKKVEDM
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Catalyzes the GTP-dependent ribosomal translocation step during translation elongation. During this step, the ribosome changes from the pre-translocational (PRE) to the post-translocational (POST) state as the newly formed A-site-bound peptidyl-tRNA and P-site-bound deacylated tRNA move to the P and E sites, respectively. Catalyzes the coordinated movent of the two tRNA molecules, the mRNA and conformational changes in the ribosome.
ncbi gi num :
33859482
ncbi acc num :
NP_031933.1
ncbi gb acc num :
NM_007907.2
uniprot acc num :
P58252
ncbi mol weight :
97.1KD
ncbi pathways :
AMPK Signaling Pathway (989651); AMPK Signaling Pathway (992181); Eukaryotic Translation Elongation Pathway (1323889); Gamma Carboxylation, Hypusine Formation And Arylsulfatase Activation Pathway (1324159); Gene Expression Pathway (1323801); Metabolism Of Proteins Pathway (1324154); Oxytocin Signaling Pathway (953445); Oxytocin Signaling Pathway (960764); Peptide Chain Elongation Pathway (1323890); Post-translational Protein Modification Pathway (1324158)
uniprot summary :
EEF2: a member of the GTP-binding translation elongation factor family. An essential factor for protein synthesis. Promotes the GTP-dependent translocation of the nascent protein chain from the A-site to the P-site of the ribosome. This protein is completely inactivated by eEF2 kinase phosphorylation. eEF2 kinase is normally dependent on Ca2+ ions and calmodulin. eEF2 kinase can also be activated by PKA in response to elevated cAMP levels, which are generally increased in stress- or starvation-related conditions. A variety of treatments known to raise intracellular Ca2+ or cAMP levels have been shown to result in increased phosphorylation of eEF2, and thus to inhibit peptide-chain elongation. Protein type: Translation elongation; Translation. Cellular Component: cytoplasm; cytosol; lipid raft; membrane; nucleus; plasma membrane; polysomal ribosome; polysome; ribonucleoprotein complex. Molecular Function: 5S rRNA binding; actin filament binding; GTP binding; GTPase activity; nucleotide binding; p53 binding; protein binding; protein kinase binding; ribosome binding; RNA binding; translation elongation factor activity. Biological Process: hemopoietic progenitor cell differentiation; positive regulation of translation; translation; translational elongation
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
1 mg (E-Coli)
price4 :
1180
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!