product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Macaca mulatta (Rhesus macaque) Interleukin-5 (IL5)
catalog :
MBS966223
quantity :
1 mg (E-Coli)
price :
1180 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS966223
products type :
Recombinant Protein
products full name :
Recombinant Macaca mulatta (Rhesus macaque) Interleukin-5 (IL5)
products short name :
(Rhesus macaque) Interleukin-5 (IL5)
products name syn :
Recombinant (Rhesus macaque) Interleukin-5 (IL5); Interleukin-5; IL-5; Eosinophil differentiation factor T-cell replacing factor; TRF
other names :
interleukin-5; Interleukin-5; interleukin-5; TRF; IL-5; T-cell replacing factor; eosinophil differentiation factor; Eosinophil differentiation factor; T-cell replacing factor
products gene name syn :
IL5
other gene names :
IL5; IL5; IL-5; TRF
uniprot entry name :
IL5_MACMU
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
20-134
sequence length :
134
sequence :
IPTEIPASALVKETLALLSTHRTLLIANETLRIPVPVHK
NHQLCTEEIFQGIGTLESQTVQGGTVERLFKNLSLIKKY
IGGQKKKCGEERRRVNQFLDYLQEFLGVMNTEWIIES
purity :
>90%
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Species: Macaca mulatta (Rhesus macaque)
ncbi gi num :
114052046
ncbi acc num :
NP_001040598.1
ncbi gb acc num :
NM_001047133.1
uniprot acc num :
P48093
ncbi mol weight :
15,150 Da
ncbi pathways :
Allograft Rejection Pathway (86789); Allograft Rejection Pathway (535); Asthma Pathway (86786); Asthma Pathway (532); Autoimmune Thyroid Disease Pathway (86787); Autoimmune Thyroid Disease Pathway (533); Cytokine-cytokine Receptor Interaction Pathway (86721); Cytokine-cytokine Receptor Interaction Pathway (460); Fc Epsilon RI Signaling Pathway (86752); Fc Epsilon RI Signaling Pathway (493)
uniprot summary :
Function: Factor that induces terminal differentiation of late-developing B-cells to immunoglobulin secreting cells . By similarity. Subunit structure: Homodimer; disulfide-linked . By similarity. Subcellular location: Secreted. Sequence similarities: Belongs to the IL-5 family.
size1 :
1 mg (E-Coli)
price1 :
1180 USD
size2 :
1 mg (Yeast)
price2 :
1640
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!