protein

Recombinant Mouse Acetylcholine receptor subunit alpha

MBS966167

0.05 mg (Yeast)

190 USD

Recombinant Protein

Recombinant Mouse Acetylcholine receptor subunit alpha

Acetylcholine receptor subunit alpha

acetylcholine receptor subunit alpha; Acetylcholine receptor subunit alpha; acetylcholine receptor subunit alpha; cholinergic receptor, nicotinic, alpha polypeptide 1 (muscle)

Chrna1

Chrna1; Chrna1; Acra; Achr-1; AI385656; AI608266; Acra

ACHA_MOUSE

E Coli or Yeast or Baculovirus or Mammalian Cell

21-230, Partial, provide the complete extracellular domain

230

SEHETRLVAKLFEDYSSVVRPVEDHREIVQVTVGLQLIQ
LINVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKI
HIPSEKIWRPDVVLYNNADGDFAIVKFTKVLLDYTGHIT
WTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVV
AINPESDQPDLSNFMESGEWVIKEARGWKHWVFYSCCPT
TPYLDITYHFVMQRL

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.

Nucleotide sequence of the mouse muscle nicotinic acetylcholine receptor alpha subunit.Isenberg K.E., Mudd J., Shah V., Merlie J.P.Nucleic Acids Res. 14:5111-5111(1986) Boulter J. Isolation of a clone coding for the alpha-subunit of a mouse acetylcholine receptor.Boulter J., Luyten W., Evans K., Mason P., Ballivet M., Goldman D.J., Stengelin S.F., Martin G., Heinemann S.F., Patrick J.J. Neurosci. 5:2545-2552(1985) Crystal structure of the extracellular domain of nAChR alpha1 bound to alpha-bungarotoxin at 1.94 A resolution.Dellisanti C.D., Yao Y., Stroud J.C., Wang Z.Z., Chen L.Nat. Neurosci. 10:953-962(2007)

31542391

NP_031415.2

NM_007389.5

P04756

26.5kD

Acetylcholine Binding And Downstream Events Pathway (1323472); Activation Of Nicotinic Acetylcholine Receptors Pathway (1323473); Highly Calcium Permeable Nicotinic Acetylcholine Receptors Pathway (1323475); Highly Calcium Permeable Postsynaptic Nicotinic Acetylcholine Receptors Pathway (1323478); Neuroactive Ligand-receptor Interaction Pathway (83250); Neuroactive Ligand-receptor Interaction Pathway (462); Neuronal System Pathway (1323448); Neurotransmitter Receptor Binding And Downstream Transmission In The Postsynaptic Cell Pathway (1323471); Postsynaptic Nicotinic Acetylcholine Receptors Pathway (1323477); Presynaptic Nicotinic Acetylcholine Receptors Pathway (1323474)

This gene encodes an alpha subunit of the muscle-derived nicotinic acetylcholine receptor, a pentameric neurotransmitter receptor and member of the ligand-gated ion channel superfamily. The alpha subunit plays a role in substrate binding and channel gating. [provided by RefSeq, Nov 2012]

nAChRA1: After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. Defects in CHRNA1 are a cause of multiple pterygium syndrome lethal type (MUPSL). Multiple pterygia are found infrequently in children with arthrogryposis and in fetuses with fetal akinesia syndrome. In lethal multiple pterygium syndrome there is intrauterine growth retardation, multiple pterygia, and flexion contractures causing severe arthrogryposis and fetal akinesia. Subcutaneous edema can be severe, causing fetal hydrops with cystic hygroma and lung hypoplasia. Oligohydramnios and facial anomalies are frequent. The alpha subunit is the main focus for antibody binding in myasthenia gravis. Myasthenia gravis is characterized by sporadic muscular fatigability and weakness, occurring chiefly in muscles innervated by cranial nerves, and characteristically improved by cholinesterase-inhibiting drugs. Defects in CHRNA1 are a cause of congenital myasthenic syndrome slow-channel type (SCCMS). SCCMS is the most common congenital myasthenic syndrome. Congenital myasthenic syndromes are characterized by muscle weakness affecting the axial and limb muscles (with hypotonia in early-onset forms), the ocular muscles (leading to ptosis and ophthalmoplegia), and the facial and bulbar musculature (affecting sucking and swallowing, and leading to dysphonia). The symptoms fluctuate and worsen with physical effort. SCCMS is caused by kinetic abnormalities of the AChR, resulting in prolonged endplate currents and prolonged AChR channel opening episodes. Defects in CHRNA1 are a cause of congenital myasthenic syndrome fast-channel type (FCCMS). FCCMS is a congenital myasthenic syndrome characterized by kinetic abnormalities of the AChR. In most cases, FCCMS is due to mutations that decrease activity of the AChR by slowing the rate of opening of the receptor channel, speeding the rate of closure of the channel, or decreasing the number of openings of the channel during ACh occupancy. The result is failure to achieve threshold depolarization of the endplate and consequent failure to fire an action potential. Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Alpha- 1/CHRNA1 sub-subfamily. 2 isoforms of the human protein are produced by alternative splicing. Protein type: Membrane protein, integral; Channel, cation; Channel, ligand-gated; Membrane protein, multi-pass; Receptor, misc. Cellular Component: cell junction; cell surface; integral to membrane; membrane; neuromuscular junction; nicotinic acetylcholine-gated receptor-channel complex; plasma membrane; postsynaptic membrane; synapse. Molecular Function: acetylcholine binding; acetylcholine receptor activity; extracellular ligand-gated ion channel activity; ion channel activity; nicotinic acetylcholine-activated cation-selective channel activity; protein binding. Biological Process: cation transport; generation of action potential; ion transport; muscle maintenance; musculoskeletal movement; neuromuscular junction development; neuromuscular process; neuromuscular synaptic transmission; regulation of membrane potential; response to nicotine; skeletal muscle contraction; skeletal muscle growth; synaptic transmission, cholinergic; transport

0.05 mg (Yeast)

190 USD

0.05 mg (E-Coli)

190

0.2 mg (E-Coli)

460

0.2 mg (Yeast)

460

0.5 mg (Yeast)

750