This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
MyBioSource
product type :
protein
product name :
Recombinant Macaca mulatta (Rhesus macaque) Growth hormone receptor (GHR)
catalog :
MBS966074
quantity :
1 mg (E-Coli)
price :
1480 USD
product information
catalog number :
MBS966074
products type :
Recombinant Protein
products full name :
Recombinant Macaca mulatta (Rhesus macaque) Growth hormone receptor (GHR)
products short name :
(Rhesus macaque) Growth hormone receptor (GHR)
products name syn :
Recombinant (Rhesus macaque) Growth hormone receptor (GHR); Growth hormone receptor; GH receptor; Somatotropin receptor Cleaved into the following chain: 1. Growth hormone-binding protein; 2. GH-binding protein; 3. GHBP; Serum-binding protein
other names :
growth hormone receptor; Growth hormone receptor; growth hormone receptor; GH receptor; somatotropin receptor; Somatotropin receptorCleaved into the following chain:Growth hormone-binding protein; GH-binding protein; GHBP; Alternative name(s):; Serum-binding protein
products gene name syn :
GHR
other gene names :
GHR; GHR; GH receptor; GH-binding protein; GHBP
uniprot entry name :
GHR_MACMU
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
19-264
sequence length :
638
sequence :
FSGSEPTAAILSRASWSLQSVNPGLKTNSSKEPKFTKCR
SPERETFSCHWTDAVHHGSKSLGPIQLFYTRRNIQGQTQ
EWKECPDYVSAGENSCYFNSSFTSVWIPYCIKLTSNGDT
VDGKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADILVR
WEAPPNADIQKGWMVLEYELQYKEVNETKWKMMDPILST
SVPVYSLKVDKEYEVLVRSKRRNSRNYGEFSEVLYVTLP
QMNQFTCEEDFY
purity :
>90%
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Species: Macaca mulatta (Rhesus macaque)
ncbi gi num :
111154114
ncbi acc num :
NP_001036132.1
ncbi gb acc num :
NM_001042667.1
uniprot acc num :
P79194
ncbi mol weight :
71,328 Da
ncbi pathways :
Cytokine-cytokine Receptor Interaction Pathway (86721); Cytokine-cytokine Receptor Interaction Pathway (460); Jak-STAT Signaling Pathway (86747); Jak-STAT Signaling Pathway (488); Neuroactive Ligand-receptor Interaction Pathway (86723); Neuroactive Ligand-receptor Interaction Pathway (462)
uniprot summary :
Function: Receptor for pituitary gland growth hormone involved in regulating postnatal body growth. On ligand binding, couples to, and activates the JAK2/STAT5 pathway . By similarity.The soluble form (GHBP) acts as a reservoir of growth hormone in plasma and may be a modulator/inhibitor of GH signaling. Subunit structure: On growth hormone (GH) binding, forms homodimers and binds JAK2 via a box 1-containing domain . By similarity. Binding to SOCS3 inhibits JAK2 activation, binding to CIS and SOCS2 inhibits STAT5 activation . By similarity. Subcellular location: Cell membrane; Single-pass type I membrane protein . By similarity. Note: On growth hormone binding, GHR is ubiquitinated, internalized, down-regulated and transported into a degradative or non-degradative pathway . By similarity.Growth hormone-binding protein: Secreted . By similarity. Note: Complexed to a substantial fraction of circulating GH . By similarity. Domain: The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.The box 1 motif is required for JAK interaction and/or activation.The extracellular domain is the ligand-binding domain representing the growth hormone-binding protein (GHBP).The ubiquitination-dependent endocytosis motif (UbE) is required for recruitment of the ubiquitin conjugation system on to the receptor and for its internalization . By similarity. Post-translational modification: On GH binding, phosphorylated on tyrosine residues in the cytoplasmic domain by JAK2 . By similarity.On ligand binding, ubiquitinated on lysine residues in the cytoplasmic domain. This ubiquitination is not sufficient for GHR internalization . By similarity. Sequence similarities: Belongs to the type I cytokine receptor family. Type 1 subfamily.Contains 1 fibronectin type-III domain.
size1 :
1 mg (E-Coli)
price1 :
1480 USD
size2 :
1 mg (Yeast)
price2 :
1940
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!