catalog number :
MBS966074
products type :
Recombinant Protein
products full name :
Recombinant Macaca mulatta (Rhesus macaque) Growth hormone receptor (GHR)
products short name :
(Rhesus macaque) Growth hormone receptor (GHR)
products name syn :
Recombinant (Rhesus macaque) Growth hormone receptor (GHR); Growth hormone receptor; GH receptor; Somatotropin receptor Cleaved into the following chain: 1. Growth hormone-binding protein; 2. GH-binding protein; 3. GHBP; Serum-binding protein
other names :
growth hormone receptor; Growth hormone receptor; growth hormone receptor; GH receptor; somatotropin receptor; Somatotropin receptorCleaved into the following chain:Growth hormone-binding protein; GH-binding protein; GHBP; Alternative name(s):; Serum-binding protein
products gene name syn :
GHR
other gene names :
GHR; GHR; GH receptor; GH-binding protein; GHBP
uniprot entry name :
GHR_MACMU
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
19-264
sequence :
FSGSEPTAAILSRASWSLQSVNPGLKTNSSKEPKFTKCR
SPERETFSCHWTDAVHHGSKSLGPIQLFYTRRNIQGQTQ
EWKECPDYVSAGENSCYFNSSFTSVWIPYCIKLTSNGDT
VDGKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADILVR
WEAPPNADIQKGWMVLEYELQYKEVNETKWKMMDPILST
SVPVYSLKVDKEYEVLVRSKRRNSRNYGEFSEVLYVTLP
QMNQFTCEEDFY
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Species: Macaca mulatta (Rhesus macaque)
ncbi acc num :
NP_001036132.1
ncbi gb acc num :
NM_001042667.1
ncbi mol weight :
71,328 Da
ncbi pathways :
Cytokine-cytokine Receptor Interaction Pathway (86721); Cytokine-cytokine Receptor Interaction Pathway (460); Jak-STAT Signaling Pathway (86747); Jak-STAT Signaling Pathway (488); Neuroactive Ligand-receptor Interaction Pathway (86723); Neuroactive Ligand-receptor Interaction Pathway (462)
uniprot summary :
Function: Receptor for pituitary gland growth hormone involved in regulating postnatal body growth. On ligand binding, couples to, and activates the JAK2/STAT5 pathway . By similarity.The soluble form (GHBP) acts as a reservoir of growth hormone in plasma and may be a modulator/inhibitor of GH signaling. Subunit structure: On growth hormone (GH) binding, forms homodimers and binds JAK2 via a box 1-containing domain . By similarity. Binding to SOCS3 inhibits JAK2 activation, binding to CIS and SOCS2 inhibits STAT5 activation . By similarity. Subcellular location: Cell membrane; Single-pass type I membrane protein . By similarity. Note: On growth hormone binding, GHR is ubiquitinated, internalized, down-regulated and transported into a degradative or non-degradative pathway . By similarity.Growth hormone-binding protein: Secreted . By similarity. Note: Complexed to a substantial fraction of circulating GH . By similarity. Domain: The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.The box 1 motif is required for JAK interaction and/or activation.The extracellular domain is the ligand-binding domain representing the growth hormone-binding protein (GHBP).The ubiquitination-dependent endocytosis motif (UbE) is required for recruitment of the ubiquitin conjugation system on to the receptor and for its internalization . By similarity. Post-translational modification: On GH binding, phosphorylated on tyrosine residues in the cytoplasmic domain by JAK2 . By similarity.On ligand binding, ubiquitinated on lysine residues in the cytoplasmic domain. This ubiquitination is not sufficient for GHR internalization . By similarity. Sequence similarities: Belongs to the type I cytokine receptor family. Type 1 subfamily.Contains 1 fibronectin type-III domain.