Recombinant Human Potassium-transporting ATPase subunit beta | MyBioSource MBS965895 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Potassium-transporting ATPase subunit beta

catalog :

MBS965895

quantity :

0.05 mg (Yeast)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS965895

products type :

Recombinant Protein

products full name :

Recombinant Human Potassium-transporting ATPase subunit beta

products short name :

Potassium-transporting ATPase subunit beta

products name syn :

Gastric H(+)/K(+) ATPase subunit beta; Proton pump beta chain

other names :

potassium-transporting ATPase subunit beta; Potassium-transporting ATPase subunit beta; potassium-transporting ATPase subunit beta; ATPase H+/K+ transporting beta subunit; Gastric H(+)/K(+) ATPase subunit beta; Proton pump beta chain

products gene name :

ATP4B

other gene names :

ATP4B; ATP4B; ATP6B

uniprot entry name :

ATP4B_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

58-291; Provide the complete extracellular domain

sequence length :

291

sequence :

CLYVLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEI
VYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQ
YFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEE
GKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQP
LQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLN
IPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Transport

products description :

Required for stabilization and maturation of the catalytic proton pump alpha subunit and may also involved in cell adhesion and establishing epithelial cell polarity.

products references :

cDNA cloning of the beta-subunit of the human gastric H,K-ATPase.Ma J.-Y., Song Y.-H., Sjoestrand S.E., Rask L., Maardh S.Biochem. Biophys. Res. Commun. 180:39-45(1991) The DNA sequence and analysis of human chromosome 13.Dunham A., Matthews L.H., Burton J., Ashurst J.L., Howe K.L., Ashcroft K.J., Beare D.M., Burford D.C., Hunt S.E., Griffiths-Jones S., Jones M.C., Keenan S.J., Oliver K., Scott C.E., Ainscough R., Almeida J.P., Ambrose K.D., Andrews D.T., Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Bannerjee R., Barlow K.F., Bates K., Beasley H., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burrill W., Carder C., Carter N.P., Chapman J.C., Clamp M.E., Clark S.Y., Clarke G., Clee C.M., Clegg S.C., Cobley V., Collins J.E., Corby N., Coville G.J., Deloukas P., Dhami P., Dunham I., Dunn M., Earthrowl M.E., Ellington A.G., Faulkner L., Frankish A.G., Frankland J., French L., Garner P., Garnett J., Gilbert J.G.R., Gilson C.J., Ghori J., Grafham D.V., Gribble S.M., Griffiths C., Hall R.E., Hammond S., Harley J.L., Hart E.A., Heath P.D., Howden P.J., Huckle E.J., Hunt P.J., Hunt A.R., Johnson C., Johnson D., Kay M., Kimberley A.M., King A., Laird G.K., Langford C.J., Lawlor S., Leongamornlert D.A., Lloyd D.M., Lloyd C., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., McLaren S.J., McMurray A., Milne S., Moore M.J.F., Nickerson T., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K.M., Rice C.M., Searle S., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Steward C.A., Sycamore N., Tester J., Thomas D.W., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Wilming L., Wray P.W., Wright M.W., Young L., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Beck S., Bentley D.R., Rogers J., Ross M.T.Nature 428:522-528(2004)

ncbi gi num :

4557339

ncbi acc num :

NP_000696.1

ncbi gb acc num :

NM_000705.3

uniprot acc num :

P51164

ncbi mol weight :

54kD

ncbi pathways :

Collecting Duct Acid Secretion Pathway (147586); Collecting Duct Acid Secretion Pathway (147560); Gastric Acid Secretion Pathway (154409); Gastric Acid Secretion Pathway (154383); Ion Channel Transport Pathway (1269950); Ion Transport By P-type ATPases Pathway (1269951); Oxidative Phosphorylation Pathway (82942); Oxidative Phosphorylation Pathway (303); Transmembrane Transport Of Small Molecules Pathway (1269903)

ncbi summary :

The protein encoded by this gene belongs to a family of P-type cation-transporting ATPases. The gastric H+, K+-ATPase is a heterodimer consisting of a high molecular weight catalytic alpha subunit and a smaller but heavily glycosylated beta subunit. This enzyme is a proton pump that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for gastric acid secretion. This gene encodes the beta subunit of the gastric H+, K+-ATPase. [provided by RefSeq, Jul 2008]

uniprot summary :

ATP4B: belongs to a family of P-type cation-transporting ATPases. The gastric H+, K+-ATPase is a heterodimer consisting of a high molecular weight catalytic alpha subunit and a smaller but heavily glycosylated beta subunit. This enzyme is a proton pump that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for gastric acid secretion. This gene encodes the beta subunit of the gastric H+, K+-ATPase. [provided by RefSeq, Jul 2008]. Protein type: Membrane protein, integral. Chromosomal Location of Human Ortholog: 13q34. Cellular Component: plasma membrane; sodium:potassium-exchanging ATPase complex. Molecular Function: hydrogen:potassium-exchanging ATPase activity; protein binding. Biological Process: cell adhesion; potassium ion transport; response to lipopolysaccharide; response to organic nitrogen; sodium ion transport; transmembrane transport

size1 :

0.05 mg (Yeast)

price1 :

190 USD

size2 :

0.05 mg (E-Coli)

price2 :

190

size3 :

0.2 mg (E-Coli)

price3 :

460

size4 :

0.2 mg (Yeast)

price4 :

460

size5 :

0.5 mg (Yeast)

price5 :

750

more info or order :

MyBioSource product webpage