Recombinant Rat Steroid 17-alpha-hydroxylase/17,20 lyase | MyBioSource MBS965707 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Rat Steroid 17-alpha-hydroxylase/17,20 lyase

catalog :

MBS965707

quantity :

0.01 mg (E-Coli)

price :

135 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS965707

products type :

Recombinant Protein

products full name :

Recombinant Rat Steroid 17-alpha-hydroxylase/17,20 lyase

products short name :

Steroid 17-alpha-hydroxylase/17,20 lyase

products name syn :

Rattus norvegicus (Rat)

other names :

steroid 17-alpha-hydroxylase/17,20 lyase; Steroid 17-alpha-hydroxylase/17,20 lyase; steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, family 17, subfamily a, polypeptide 1; 17-alpha-hydroxyprogesterone aldolase; CYPXVII; Cytochrome P450 17A1; Cytochrome P450-C17; Cytochrome P450c17

products gene name :

Cyp17a1

other gene names :

Cyp17a1; Cyp17a1; Cyp17; Cyp17; Cytochrome P450c17

uniprot entry name :

CP17A_RAT

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

1-507

sequence length :

507

sequence :

MWELVGLLLLILAYFFWVKSKTPGAKLPRSLPSLPLVGS
LPFLPRRGHMHVNFFKLQEKYGPIYSLRLGTTTTVIIGH
YQLAREVLIKKGKEFSGRPQMVTQSLLSDQGKGVAFADA
GSSWHLHRKLVFSTFSLFKDGQKLEKLICQEAKSLCDMM
LAHDKESIDLSTPIFMSVTNIICAICFNISYEKNDPKLT
AIKTFTEGIVDATGDRNLVDIFPWLTIFPNKGLEVIKGY
AKVRNEVLTGIFEKCREKFDSQSISSLTDILIQAKMNSD
NNNSCEGRDPDVFSDRHILATVGDIFGAGIETTTTVLKW
ILAFLVHNPEVKKKIQKEIDQYVGFSRTPTFNDRSHLLM
LEATIREVLRIRPVAPMLIPHKANVDSSIGEFTVPKDTH
VVVNLWALHHDENEWDQPDQFMPERFLDPTGSHLITPTQ
SYLPFGAGPRSCIGEALARQELFVFTALLLQRFDLDVSD
DKQLPRLEGDPKVVFLIDPFKVKITVRQAWMDAQAEVST

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

other info2 :

Species: Rat

products categories :

Metabolism

products description :

Conversion of pregnenolone and progesterone to their 17-alpha-hydroxylated products and subsequently to dehydroepiandrosterone (DHEA) and androstenedione. Catalyzes both the 17-alpha-hydroxylation and the 17,20-lyase reaction. Involved in sexual development during fetal life and at puberty.

products references :

Rat P450(17 alpha) from testis: characterization of a full-length cDNA encoding a unique steroid hydroxylase capable of catalyzing both delta 4- and delta 5-steroid-17,20-lyase reactions." Fevold H.R., Lorence M.C., McCarthy J.L., Trant J.M., Kagimoto M., Waterman M.R., Mason J.I. Mol. Endocrinol. 3:968-975(1989)

ncbi gi num :

6978731

ncbi acc num :

NP_036885.1

ncbi gb acc num :

NM_012753.2

uniprot acc num :

P11715

ncbi mol weight :

73.21kD

ncbi pathways :

Androgen Biosynthesis Pathway (1333360); Biological Oxidations Pathway (1333500); Biosynthesis Of Aldosterone And Cortisol Pathway (198520); C19/C18-Steroid Hormone Biosynthesis, Pregnenolone = Androstenedione = Estrone Pathway (434699); C19/C18-Steroid Hormone Biosynthesis, Pregnenolone = Androstenedione = Estrone Pathway (468268); C21-Steroid Hormone Biosynthesis, Progesterone = Cortisol/cortisone Pathway (434709); C21-Steroid Hormone Biosynthesis, Progesterone = Cortisol/cortisone Pathway (468370); Cytochrome P450 - Arranged By Substrate Type Pathway (1333502); Endogenous Sterols Pathway (1333503); Glucocorticoid Metabolism Pathway (198485)

ncbi summary :

steroid hydroxylase that comprises a main component of the steroidogenic pathway; activity culminates in corticosteriod and androgen production in adrenal gland and sex steroid production in gonads [RGD, Feb 2006]

uniprot summary :

CYP17A1: Conversion of pregnenolone and progesterone to their 17- alpha-hydroxylated products and subsequently to dehydroepiandrosterone (DHEA) and androstenedione. Catalyzes both the 17-alpha-hydroxylation and the 17,20-lyase reaction. Involved in sexual development during fetal life and at puberty. Defects in CYP17A1 are the cause of adrenal hyperplasia type 5 (AH5). AH5 is a form of congenital adrenal hyperplasia, a common recessive disease due to defective synthesis of cortisol. Congenital adrenal hyperplasia is characterized by androgen excess leading to ambiguous genitalia in affected females, rapid somatic growth during childhood in both sexes with premature closure of the epiphyses and short adult stature. Four clinical types: salt wasting (SW, the most severe type), simple virilizing (SV, less severely affected patients), with normal aldosterone biosynthesis, non-classic form or late onset (NC or LOAH), and cryptic (asymptomatic). Belongs to the cytochrome P450 family. Protein type: Oxidoreductase; EC 1.14.99.9; EC 4.1.2.30; Lipid Metabolism - C21-steroid hormone. Cellular Component: axon; cell projection; cell soma; endoplasmic reticulum; intracellular membrane-bound organelle; membrane; mitochondrion. Molecular Function: 17-alpha-hydroxyprogesterone aldolase activity; heme binding; iron ion binding; steroid 17-alpha-monooxygenase activity. Biological Process: adrenal gland development; androgen biosynthetic process; biphenyl metabolic process; dibenzo-p-dioxin metabolic process; glucocorticoid biosynthetic process; hippocampus development; hormone biosynthetic process; Leydig cell differentiation; male gonad development; organic acid metabolic process; ovulation; phenol metabolic process; phthalate metabolic process; progesterone metabolic process; response to acetate; response to cAMP; response to cytokine stimulus; response to drug; response to herbicide; response to insecticide; response to ionizing radiation; response to methylmercury; response to nutrient levels; response to organic cyclic substance; response to organic substance; response to retinoic acid; response to steroid hormone stimulus; response to toxin; steroid biosynthetic process; steroid metabolic process

size1 :

0.01 mg (E-Coli)

price1 :

135 USD

size2 :

0.05 mg (E-Coli)

price2 :

255

size3 :

0.2 mg (E-Coli)

price3 :

665

size4 :

0.5 mg (E-Coli)

price4 :

1090

size5 :

0.05 mg (Baculovirus)

price5 :

1295

more info or order :

MyBioSource product webpage