protein

Recombinant Human Follicle-stimulating hormone receptor

MBS965616

0.05 mg (E-Coli)

185 USD

Recombinant Protein

Recombinant Human Follicle-stimulating hormone receptor

Follicle-stimulating hormone receptor

Follitropin receptor

follicle-stimulating hormone receptor isoform 1; Follicle-stimulating hormone receptor; follicle-stimulating hormone receptor; follicle stimulating hormone receptor; Follitropin receptor

FSHR

FSHR; FSHR; LGR1; ODG1; FSHR1; FSHRO; LGR1; FSH-R

FSHR_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

18-366

695

CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLT
KLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLP
KLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKH
LPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESV
ILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPND
VFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYN
LKKLPTLEKLVALMEASLTYP

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Neuroscience

Receptor for follicle-stimulating hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.

Cloning and sequencing of human FSH receptor cDNA.Minegish T., Nakamura K., Takakura Y., Ibuki Y., Igarashi M.Biochem. Biophys. Res. Commun. 175:1125-1130(1991) Expression of recombinant human follicle-stimulating hormone receptor species-specific ligand binding, signal transduction, and identification of multiple ovarian messenger ribonucleic acid transcripts.Tilly J.L., Aihara T., Nishimori K., Jia X.-C., Billig H., Kowalski K.I., Perlas E.A., Hsueh A.J.Endocrinology 131:799-806(1992) The cloning of the human follicle stimulating hormone receptor and its expression in COS-7, CHO, and Y-1 cells.Kelton C.A., Cheng S.V., Nugent N.P., Schweickhardt R.L., Rosenthal J.L., Overton S.A., Wands G.D., Kuzeja J.B., Luchette C.A., Chappel S.C.Mol. Cell. Endocrinol. 89:141-151(1992) FSHR expression in adipose tissue.Liu X., Huang H., Sheng J. cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org) .Kopatz S.A., Aronstam R.S., Sharma S.V. Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) Generation and annotation of the DNA sequences of human chromosomes 2 and 4.Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.Nature 434:724-731(2005) Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C. Molecular cloning of a truncated isoform of the human follicle stimulating hormone receptor.Gromoll J., Gudermann T., Nieschlag E.Biochem. Biophys. Res. Commun. 188:1077-1083(1992) Characterization of the 5' flanking region of the human follicle-stimulating hormone receptor gene.Gromoll J., Dankbar B., Gudermann T.Mol. Cell. Endocrinol. 102:93-102(1994) Localization of the human FSH receptor to chromosome 2p21 using a genomic probe comprising exon 10.Gromoll J., Ried T., Holtgreve-Grez H., Nieschlag E., Gudermann T.J. Mol. Endocrinol. 12:265-271(1994) Alternatively spliced variants of the follicle-stimulating hormone receptor gene in the testis of infertile men.Song G.J., Park Y.S., Lee Y.S., Lee C.C., Kang I.S.Fertil. Steril. 77:499-504(2002) Structural predictions for the ligand-binding region of glycoprotein hormone receptors and the nature of hormone-receptor interactions.Jiang X., Dreano M., Buckler D.R., Cheng S., Ythier A., Wu H., Hendrickson W.A., el Tayar N.Structure 3:1341-1353(1995) Structure of human follicle-stimulating hormone in complex with its receptor.Fan Q.R., Hendrickson W.A.Nature 433:269-277(2005) Mutation in the follicle-stimulating hormone receptor gene causes hereditary hypergonadotropic ovarian failure.Aittomaeki K., Lucena J.L.D., Pakarinen P., Sistonen P., Tapanainen J., Gromoll J., Kaskikari R., Sankila E.-M., Lehvaslaiho H., Engel A.R., Nieschlag E., Huhtaniemi I., de la Chapelle A.Cell 82:959-968(1995) A mutation in the follicle-stimulating hormone receptor occurs frequently in human ovarian sex cord tumors.Kotlar T.J., Young R.H., Albanese C., Crowley W.F. Jr., Scully R.E., Jameson J.L.J. Clin. Endocrinol. Metab. 82:1020-1026(1997) An activating mutation of the follicle-stimulating hormone receptor autonomously sustains spermatogenesis in a hypophysectomized man.Gromoll J., Simoni M., Nieschlag E.J. Clin. Endocrinol. Metab. 81:1367-1370(1996) The frequency of an inactivating point mutation (566C-->T) of the human follicle-stimulating hormone receptor gene in four populations using allele-specific hybridization and time-resolved fluorometry.Jiang M., Aittomaeki K., Nilsson C., Pakarinen P., Iitia A., Torresani T., Simonsen H., Goh V., Pettersson K., de la Chapelle A., Huhtaniemi I.J. Clin. Endocrinol. Metab. 83:4338-4343(1998) A novel phenotype related to partial loss of function mutations of the follicle stimulating hormone receptor.Beau I., Touraine P., Meduri G., Gougeon A., Desroches A., Matuchansky C., Milgrom E., Kuttenn F., Misrahi M.J. Clin. Invest. 102:1352-1359(1998) New natural inactivating mutations of the follicle-stimulating hormone receptor correlations between receptor function and phenotype.Touraine P., Beau I., Gougeon A., Meduri G., Desroches A., Pichard C., Detoeuf M., Paniel B., Prieur M., Zorn J.-R., Milgrom E., Kuttenn F., Misrahi M.Mol. Endocrinol. 13:1844-1854(1999) Characterization of single-nucleotide polymorphisms in coding regions of human genes.Cargill M., Altshuler D., Ireland J., Sklar P., Ardlie K., Patil N., Shaw N., Lane C.R., Lim E.P., Kalyanaraman N., Nemesh J., Ziaugra L., Friedland L., Rolfe A., Warrington J., Lipshutz R., Daley G.Q., Lander E.S.Nat. Genet. 22:231-238(1999) ErratumCargill M., Altshuler D., Ireland J., Sklar P., Ardlie K., Patil N., Shaw N., Lane C.R., Lim E.P., Kalyanaraman N., Nemesh J., Ziaugra L., Friedland L., Rolfe A., Warrington J., Lipshutz R., Daley G.Q., Lander E.S.Nat. Genet. 23:373-373(1999) Distribution and function of FSH receptor genetic variants in normal men.Asatiani K., Gromoll J., Eckardstein S.V., Zitzmann M., Nieschlag E., Simoni M.Andrologia 34:172-176(2002) A novel mutation in the FSH receptor inhibiting signal transduction and causing primary ovarian failure.Doherty E., Pakarinen P., Tiitinen A., Kiilavuori A., Huhtaniemi I., Forrest S., Aittomaeki K.J. Clin. Endocrinol. Metab. 87:1151-1155(2002) A novel loss of function mutation in exon 10 of the FSH receptor gene causing hypergonadotrophic hypogonadism clinical and molecular characteristics.Allen L.A., Achermann J.C., Pakarinen P., Kotlar T.J., Huhtaniemi I.T., Jameson J.L., Cheetham T.D., Ball S.G.Hum. Reprod. 18:251-256(2003) Delayed puberty and primary amenorrhea associated with a novel mutation of the human follicle-stimulating hormone receptor clinical, histological, and molecular studies.Meduri G., Touraine P., Beau I., Lahuna O., Desroches A., Vacher-Lavenu M.C., Kuttenn F., Misrahi M.J. Clin. Endocrinol. Metab. 88:3491-3498(2003) A chorionic gonadotropin-sensitive mutation in the follicle-stimulating hormone receptor as a cause of familial gestational spontaneous ovarian hyperstimulation syndrome.Vasseur C., Rodien P., Beau I., Desroches A., Gerard C., de Poncheville L., Chaplot S., Savagner F., Croue A., Mathieu E., Lahlou N., Descamps P., Misrahi M.N. Engl. J. Med. 349:753-759(2003) Ovarian hyperstimulation syndrome due to a mutation in the follicle-stimulating hormone receptor.Smits G., Olatunbosun O., Delbaere A., Pierson R., Vassart G., Costagliola S.N. Engl. J. Med. 349:760-766(2003) A mutation in the follicle-stimulating hormone receptor as a cause of familial spontaneous ovarian hyperstimulation syndrome.Montanelli L., Delbaere A., Di Carlo C., Nappi C., Smits G., Vassart G., Costagliola S.J. Clin. Endocrinol. Metab. 89:1255-1258(2004) Presence and absence of follicle-stimulating hormone receptor mutations provide some insights into spontaneous ovarian hyperstimulation syndrome physiopathology.De Leener A., Montanelli L., Van Durme J., Chae H., Smits G., Vassart G., Costagliola S.J. Clin. Endocrinol. Metab. 91:555-562(2006) Identification of the first germline mutation in the extracellular domain of the follitropin receptor responsible for spontaneous ovarian hyperstimulation syndrome.De Leener A., Caltabiano G., Erkan S., Idil M., Vassart G., Pardo L., Costagliola S.Hum. Mutat. 29:91-98(2008) +Additional computationally mapped references. p>Provides general information on the entry.

31657138

NP_000136.2

NM_000145.3

P23945

44kD

Class A/1 (Rhodopsin-like Receptors) Pathway (1269545); FSH Signaling Pathway (672455); G Alpha (s) Signalling Events Pathway (1269575); GPCR Downstream Signaling Pathway (1269574); GPCR Ligand Binding Pathway (1269544); GPCRs, Class A Rhodopsin-like Pathway (198886); GPCRs, Other Pathway (198765); Hormone Ligand-binding Receptors Pathway (1269559); Neuroactive Ligand-receptor Interaction Pathway (83053); Neuroactive Ligand-receptor Interaction Pathway (462)

The protein encoded by this gene belongs to family 1 of G-protein coupled receptors. It is the receptor for follicle stimulating hormone and functions in gonad development. Mutations in this gene cause ovarian dysgenesis type 1, and also ovarian hyperstimulation syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]

FSHR: Receptor for follicle-stimulating hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Defects in FSHR are a cause of ovarian dysgenesis type 1 (ODG1); also known as premature ovarian failure or gonadal dysgenesis XX type or XX gonadal dysgenesis (XXGD) or hereditary hypergonadotropic ovarian failure or hypergonadotropic ovarian dysgenesis with normal karyotype. ODG1 is an autosomal recessive disease characterized by primary amenorrhea, variable development of secondary sex characteristics, and high serum levels of follicle-stimulating hormone (FSH) and luteinizing hormone (LH). Defects in FSHR are a cause of ovarian hyperstimulation syndrome (OHSS). OHSS is a disorder which occurs either spontaneously or most often as an iatrogenic complication of ovarian stimulation treatments for in vitro fertilization. The clinical manifestations vary from abdominal distention and discomfort to potentially life-threatening, massive ovarian enlargement and capillary leak with fluid sequestration. Pathologic features of this syndrome include the presence of multiple serous and hemorrhagic follicular cysts lined by luteinized cells, a condition called hyperreactio luteinalis. Belongs to the G-protein coupled receptor 1 family. FSH/LSH/TSH subfamily. 3 isoforms of the human protein are produced by alternative splicing. Protein type: Membrane protein, multi-pass; Membrane protein, integral; Receptor, GPCR; GPCR, family 1. Chromosomal Location of Human Ortholog: 2p21-p16. Cellular Component: integral to membrane; integral to plasma membrane; plasma membrane. Molecular Function: follicle-stimulating hormone receptor activity; peptide receptor activity, G-protein coupled; protein binding. Biological Process: adenylate cyclase activation; female gamete generation; female gonad development; follicle-stimulating hormone signaling pathway; G-protein coupled receptor protein signaling pathway; G-protein signaling, adenylate cyclase activating pathway; gonad development; hormone-mediated signaling; male gonad development; positive regulation of phosphoinositide 3-kinase cascade; primary ovarian follicle growth; regulation of osteoclast differentiation; spermatogenesis. Disease: Ovarian Dysgenesis 1; Ovarian Hyperstimulation Syndrome; Twinning, Dizygotic

0.05 mg (E-Coli)

185 USD

0.2 mg (E-Coli)

420

0.5 mg (E-Coli)

680

1 mg (E-Coli)

1070