product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human DNA primase small subunit (PRIM1)
catalog :
MBS965448
quantity :
0.01 mg (E-Coli)
price :
160 USD
more info or order :
MyBioSource product webpage
image
image 1 :
MyBioSource MBS965448 image 1
product information
catalog number :
MBS965448
products type :
Recombinant Protein
products full name :
Recombinant Human DNA primase small subunit (PRIM1)
products short name :
[DNA primase small subunit (PRIM1)]
products name syn :
[DNA primase small subunit; EC=2.7.7.-; DNA primase 49 kDa subunit; p49]
other names :
[DNA primase small subunit; DNA primase small subunit; DNA primase small subunit; DNA primase 1; primase p49 subunit; DNA primase subunit 48; DNA primase 49 kDa subunit; primase polypeptide 1, 49kDa; primase, DNA, polypeptide 1 (49kDa); DNA primase 49 kDa subunit; p49]
products gene name :
[PRIM1]
other gene names :
[PRIM1; PRIM1; p49; p49]
uniprot entry name :
PRI1_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[1-420aa; Full Length]
sequence length :
420
sequence :
METFDPTELPELLKLYYRRLFPYSQYYRWLNYGGVIKNY
FQHREFSFTLKDDIYIRYQSFNNQSDLEKEMQKMNPYKI
DIGAVYSHRPNQHNTVKLGAFQAQEKELVFDIDMTDYDD
VRRCCSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRL
WVYSGRRGVHCWVCDESVRKLSSAVRSGIVEYLSLVKGG
QDVKKKVHLSEKIHPFIRKSINIIKKYFEEYALVNQDIL
ENKESWDKILALVPETIHDELQQSFQKSHNSLQRWEHLK
KVASRYQNNIKNDKYGPWLEWEIMLQYCFPRLDINVSKG
INHLLKSPFSVHPKTGRISVPIDLQKVDQFDPFTVPTIS
FICRELDAISTNEEEKEENEAESDVKHRTRDYKKTSLAP
YVKVFEHFLENLDKSRKGELLKKSDLQKDF
purity :
>=90%
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
image1 heading :
SDS-PAGE
other info1 :
Species: Homo sapiens (Human)
products description :
DNA primase is the polymerase that synthesizes small RNA primers for the Okazaki fragments made during discontinuous DNA replication.
ncbi gi num :
4506051
ncbi acc num :
NP_000937.1
ncbi gb acc num :
NM_000946.2
uniprot acc num :
P49642
ncbi mol weight :
49,902 Da
ncbi pathways :
Activation Of The Pre-replicative Complex Pathway (105777); Cell Cycle Pathway (530733); Cell Cycle, Mitotic Pathway (105765); Chromosome Maintenance Pathway (161048); DNA Replication Pathway (198771); DNA Replication Pathway (105897); DNA Replication Pre-Initiation Pathway (105898); DNA Polymerase Alpha / Primase Complex Pathway (413417); DNA Polymerase Alpha / Primase Complex Pathway (890524); DNA Replication Pathway (83039)
ncbi summary :
The replication of DNA in eukaryotic cells is carried out by a complex chromosomal replication apparatus, in which DNA polymerase alpha and primase are two key enzymatic components. Primase, which is a heterodimer of a small subunit and a large subunit, synthesizes small RNA primers for the Okazaki fragments made during discontinuous DNA replication. The protein encoded by this gene is the small, 49 kDa primase subunit. [provided by RefSeq, Jul 2008]
uniprot summary :
PRIM1: DNA primase is the polymerase that synthesizes small RNA primers for the Okazaki fragments made during discontinuous DNA replication. Heterodimer of a small subunit and a large subunit. Belongs to the eukaryotic-type primase small subunit family. Protein type: Nucleotide Metabolism - pyrimidine; Nucleotide Metabolism - purine; Transferase; EC 2.7.7.-; DNA replication. Chromosomal Location of Human Ortholog: 12q13. Cellular Component: nucleoplasm; membrane. Molecular Function: DNA primase activity; metal ion binding. Biological Process: telomere maintenance via semi-conservative replication; DNA replication initiation; telomere maintenance via recombination; DNA replication, synthesis of RNA primer; DNA strand elongation during DNA replication; mitotic cell cycle; telomere maintenance; G1/S transition of mitotic cell cycle
size1 :
0.01 mg (E-Coli)
price1 :
160 USD
size2 :
0.05 mg (E-Coli)
price2 :
200
size3 :
0.1 mg (E-Coli)
price3 :
295
size4 :
0.2 mg (E-Coli)
price4 :
480
size5 :
0.5 mg (E-Coli)
price5 :
790
size6 :
1 mg (E-Coli)
price6 :
1215
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!