product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human RAC-alpha serine/threonine-protein kinase (AKT1)
catalog :
MBS965309
quantity :
0.01 mg (E-Coli)
price :
160 USD
more info or order :
product information
catalog number :
MBS965309
products type :
Recombinant Protein
products full name :
Recombinant Human RAC-alpha serine/threonine-protein kinase (AKT1)
products short name :
[RAC-alpha serine/threonine-protein kinase (AKT1)]
other names :
[RAC-alpha serine/threonine-protein kinase; RAC-alpha serine/threonine-protein kinase; RAC-alpha serine/threonine-protein kinase; AKT serine/threonine kinase 1; Protein kinase B; PKB; Protein kinase B alpha; PKB alpha; Proto-oncogene c-Akt; RAC-PK-alpha]
products gene name :
[AKT1]
other gene names :
[AKT1; AKT1; AKT; PKB; RAC; CWS6; PRKBA; PKB-ALPHA; RAC-ALPHA; PKB; RAC; PKB; PKB alpha]
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[1-480aa, Full length protein]
sequence length :
418
sequence :
MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYK
ERPQDVDQREAPLNNFSVAQCQLMKTERPRPNTFIIRCL
QWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEE
MDFRSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLL
GKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHT
LTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGE
LFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYR
DLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKTFCGT
PEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYN
QDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQ
RLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQV
TSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPH
FPQFSYSASGTA
purity :
>85% (SDS-PAGE)
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
other info1 :
Species: Human
other info2 :
Storage Buffer: Tris-based buffer, 50% glycerol
products description :
The serine-threonine protein kinase encoded by the AKT1 gene is catalytically inactive in serum-starved primary and immortalized fibroblasts. AKT1 and the related AKT2 are activated by platelet-derived growth factor. The activation is rapid and specific, and it is abrogated by mutations in the pleckstrin homology domain of AKT1. It was shown that the activation occurs through phosphatidylinositol 3-kinase. In the developing nervous system AKT is a critical mediator of growth factor-induced neuronal survival. Survival factors can suppress apoptosis in a transcription-independent manner by activating the serine. threonine kinase AKT1, which then phosphorylates and inactivates components of the apoptotic machinery. Multiple alternatively spliced transcript variants have been found for this gene.
ncbi gi num :
62241013
ncbi acc num :
NP_001014431.1
ncbi gb acc num :
NM_001014431.1
uniprot acc num :
P31749
ncbi mol weight :
48,347 Da
ncbi pathways :
AGE/RAGE Pathway (698754); AKT Phosphorylates Targets In The Cytosol Pathway (106475); AKT Phosphorylates Targets In The Nucleus Pathway (106476); AKT-mediated Inactivation Of FOXO1A Pathway (106333); AMPK Signaling Pathway (198868); Activation Of BAD And Translocation To Mitochondria Pathway (105659); Activation Of BH3-only Proteins Pathway (105658); Acute Myeloid Leukemia Pathway (83117); Acute Myeloid Leukemia Pathway (529); Adaptive Immune System Pathway (366160)
ncbi summary :
The serine-threonine protein kinase encoded by the AKT1 gene is catalytically inactive in serum-starved primary and immortalized fibroblasts. AKT1 and the related AKT2 are activated by platelet-derived growth factor. The activation is rapid and specific, and it is abrogated by mutations in the pleckstrin homology domain of AKT1. It was shown that the activation occurs through phosphatidylinositol 3-kinase. In the developing nervous system AKT is a critical mediator of growth factor-induced neuronal survival. Survival factors can suppress apoptosis in a transcription-independent manner by activating the serine/threonine kinase AKT1, which then phosphorylates and inactivates components of the apoptotic machinery. Mutations in this gene have been associated with the Proteus syndrome. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2011]
uniprot summary :
AKT1 is one of 3 closely related serine/threonine-protein kinases (AKT1, AKT2 and AKT3) called the AKT kinase, and which regulate many processes including metabolism, proliferation, cell survival, growth and angiogenesis. This is mediated through serine and/or threonine phosphorylation of a range of downstream substrates. Over 100 substrate candidates have been reported so far, but for most of them, no isoform specificity has been reported. AKT is responsible of the regulation of glucose uptake by mediating insulin-induced translocation of the SLC2A4/GLUT4 glucose transporter to the cell surface. Phosphorylation of PTPN1 at 'Ser-50' negatively modulates its phosphatase activity preventing dephosphorylation of the insulin receptor and the attenuation of insulin signaling. Phosphorylation of TBC1D4 triggers the binding of this effector to inhibitory 14-3-3 proteins, which is required for insulin-stimulated glucose transport. AKT regulates also the storage of glucose in the form of glycogen by phosphorylating GSK3A at 'Ser-21' and GSK3B at 'Ser-9', resulting in inhibition of its kinase activity. Phosphorylation of GSK3 isoforms by AKT is also thought to be one mechanism by which cell proliferation is driven. AKT regulates also cell survival via the phosphorylation of MAP3K5 (apoptosis signal-related kinase). Phosphorylation of 'Ser-83' decreases MAP3K5 kinase activity stimulated by oxidative stress and thereby prevents apoptosis. AKT mediates insulin-stimulated protein synthesis by phosphorylating TSC2 at 'Ser-939' and 'Thr-1462', thereby activating mTORC1 signaling and leading to both phosphorylation of 4E-BP1 and in activation of RPS6KB1. AKT is involved in the phosphorylation of members of the FOXO factors (Forkhead family of transcription factors), leading to binding of 14-3-3 proteins and cytoplasmic localization. In particular, FOXO1 is phosphorylated at 'Thr-24', 'Ser-256' and 'Ser-319'. FOXO3 and FOXO4 are phosphorylated on equivalent sites. AKT has an important role in the regulation of NF-kappa-B-dependent gene transcription and positively regulates the activity of CREB1 (cyclic AMP (cAMP)-response element binding protein). The phosphorylation of CREB1 induces the binding of accessory proteins that are necessary for the transcription of pro-survival genes such as BCL2 and MCL1. AKT phosphorylates 'Ser-454' on ATP citrate lyase (ACLY), thereby potentially regulating ACLY activity and fatty acid synthesis. Activates the 3B isoform of cyclic nucleotide phosphodiesterase (PDE3B) via phosphorylation of 'Ser-273', resulting in reduced cyclic AMP levels and inhibition of lipolysis. Phosphorylates PIKFYVE on 'Ser-318', which results in increased PI3P-5 activity. The Rho GTPase-activating protein DLC1 is another substrate and its phosphorylation is implicated in the regulation cell proliferation and cell growth. AKT plays a role as key modulator of the AKT-mTOR signaling pathway controlling the tempo of the process of newborn neurons integration during adult neurogenesis, including correct neuron positioning, dendritic development and synapse formation. Signals downstream of phosphatidylinositol 3-kinase (PI3K) to mediate the effects of various growth factors such as platelet-derived growth factor (PDGF), epidermal growth factor (EGF), insulin and insulin-like growth factor I (IGF-I). AKT mediates the antiapoptotic effects of IGF-I. Essential for the SPATA13-mediated regulation of cell migration and adhesion assembly and disassembly. May be involved in the regulation of the placental development. Phosphorylates STK4/MST1 at 'Thr-120' and 'Thr-387' leading to inhibition of its: kinase activity, nuclear translocation, autophosphorylation and ability to phosphorylate FOXO3. Phosphorylates STK3/MST2 at 'Thr-117' and 'Thr-384' leading to inhibition of its: cleavage, kinase activity, autophosphorylation at Thr-180, binding to RASSF1 and nuclear translocation. Phosphorylates SRPK2 and enhances its kinase activity towards SRSF2 and ACIN1 and promotes its nuclear translocation. Phosphorylates RAF1 at 'Ser-259' and negatively regulates its activity. Phosphorylation of BAD stimulates its pro-apoptotic activity. Phosphorylates KAT6A at 'Thr-369' and this phosphorylation inhibits the interaction of KAT6A with PML and negatively regulates its acetylation activity towards p53/TP53.
size1 :
0.01 mg (E-Coli)
price1 :
160 USD
size2 :
0.05 mg (E-Coli)
price2 :
200
size3 :
0.1 mg (E-Coli)
price3 :
295
size4 :
0.2 mg (E-Coli)
price4 :
480
size5 :
0.5 mg (E-Coli)
price5 :
790
size6 :
1 mg (E-Coli)
price6 :
1215
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!