product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Rat Calcium-dependent phospholipase A2
catalog :
MBS965288
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS965288
products type :
Recombinant Protein
products full name :
Recombinant Rat Calcium-dependent phospholipase A2
products short name :
Calcium-dependent phospholipase A2
products name syn :
Group V phospholipase A2; PLA2-10; Phosphatidylcholine 2-acylhydrolase 5
other names :
calcium-dependent phospholipase A2; Calcium-dependent phospholipase A2; calcium-dependent phospholipase A2; phospholipase A2, group V; Group V phospholipase A2; PLA2-10; Phosphatidylcholine 2-acylhydrolase 5
products gene name :
Pla2g5
other gene names :
Pla2g5; Pla2g5
uniprot entry name :
PA2G5_RAT
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
21-137
sequence length :
137
sequence :
GLLELKSMIEKVTGKNAVKNYGFYGCYCGWGGHGTPKDG
TDWCCRMHDRCYGLLEEKHCAIRTQSYDYRFTQDLVICE
HDSFCPVRLCACDRKLVYCLRRNLWSYNRLYQYYPNFLC
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. This isozyme hydrolyzes L-alpha-palmitoyl-2-oleoyl phosphatidylcholine more efficiently than L-alpha-1-palmitoyl-2-arachidonyl phosphatidylcholine, L-alpha-1-palmitoyl-2-arachidonyl phosphatidylethanolamine or L-alpha-1-stearoyl-2-arachidonyl phosphatidylinositol.
products references :
Cloning, expression and partial characterization of a novel rat phospholipase A2.Chen J., Engle S.J., Seilhamer J.J., Tischfield J.A.Biochim. Biophys. Acta 1215:115-120(1994) Cloning and sequence determination of rat group V phospholipase A2 from ovary.Liang N.S., Su Q.B., Li Y., Yang F., Lu Y., Xie Y.A.
ncbi gi num :
8393974
ncbi acc num :
NP_058870.1
ncbi gb acc num :
NM_017174.1
uniprot acc num :
P51433
ncbi mol weight :
29.8kD
ncbi pathways :
Acyl Chain Remodelling Of PC Pathway (1333371); Acyl Chain Remodelling Of PE Pathway (1333367); Acyl Chain Remodelling Of PG Pathway (1333378); Acyl Chain Remodelling Of PI Pathway (1333376); Acyl Chain Remodelling Of PS Pathway (1333374); Arachidonic Acid Metabolism Pathway (83383); Arachidonic Acid Metabolism Pathway (366); Ether Lipid Metabolism Pathway (83382); Ether Lipid Metabolism Pathway (365); Fat Digestion And Absorption Pathway (194376)
ncbi summary :
catalyzes calcium ion dependent hydrolysis of phospholipids [RGD, Feb 2006]
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
0.05 mg (Baculovirus)
price4 :
850
size5 :
0.05 mg (Mammalian-Cell)
price5 :
1075
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!