protein

Recombinant Human Junctional adhesion molecule B

MBS965190

0.05 mg (E-Coli)

190 USD

Recombinant Protein

Recombinant Human Junctional adhesion molecule B

Junctional adhesion molecule B

Junctional adhesion molecule 2; JAM-2; Vascular endothelial junction-associated molecule; VE-JAM; CD322

junctional adhesion molecule B isoform 2; Junctional adhesion molecule B; junctional adhesion molecule B; junctional adhesion molecule 2; Junctional adhesion molecule 2; JAM-2; Vascular endothelial junction-associated molecule; VE-JAM; CD_antigen: CD322

JAM2

C21orf43; VEJAM

JAM2; JAM2; JAMB; CD322; JAM-B; VEJAM; PRO245; VE-JAM; C21orf43; C21orf43; VEJAM; JAM-B; JAM-2; VE-JAM

JAM2_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

29-238

262

FSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLG
RSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGK
YRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSA
LSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQ
STNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYR
RCPGKRMQVDDLNIS

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Cardiovascular

May play a role in the processes of lymphocyte homing to secondary lymphoid organs.

Vascular endothelial junction-associated molecule, a novel member of the immunoglobulin superfamily, is localized to intercellular boundaries of endothelial cells.Palmeri D., van Zante A., Huang C.-C., Hemmerich S., Rosen S.D.J. Biol. Chem. 275:19139-19145(2000) A novel protein with homology to the junctional adhesion molecule Characterization of leukocyte interactions.Cunningham S.A., Arrate M.P., Rodriguez J.M., Bjercke R.J., Vanderslice P., Morris A.P., Brock T.A.J. Biol. Chem. 275:34750-34756(2000) Annotation of human chromosome 21 for relevance to Down syndrome gene structure and expression analysis.Gardiner K., Slavov D., Bechtel L., Davisson M.Genomics 79:833-843(2002) The secreted protein discovery initiative (SPDI) , a large-scale effort to identify novel human secreted and transmembrane proteins a bioinformatics assessment.Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E., Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.Genome Res. 13:2265-2270(2003) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) The DNA sequence of human chromosome 21.Hattori M., Fujiyama A., Taylor T.D., Watanabe H., Yada T., Park H.-S., Toyoda A., Ishii K., Totoki Y., Choi D.-K., Groner Y., Soeda E., Ohki M., Takagi T., Sakaki Y., Taudien S., Blechschmidt K., Polley A., Menzel U., Delabar J., Kumpf K., Lehmann R., Patterson D., Reichwald K., Rump A., Schillhabel M., Schudy A., Zimmermann W., Rosenthal A., Kudoh J., Shibuya K., Kawasaki K., Asakawa S., Shintani A., Sasaki T., Nagamine K., Mitsuyama S., Antonarakis S.E., Minoshima S., Shimizu N., Nordsiek G., Hornischer K., Brandt P., Scharfe M., Schoen O., Desario A., Reichelt J., Kauer G., Bloecker H., Ramser J., Beck A., Klages S., Hennig S., Riesselmann L., Dagand E., Wehrmeyer S., Borzym K., Gardiner K., Nizetic D., Francis F., Lehrach H., Reinhardt R., Yaspo M.-L.Nature 405:311-319(2000) Signal peptide prediction based on analysis of experimentally verified cleavage sites.Zhang Z., Henzel W.J.Protein Sci. 13:2819-2824(2004) Cloning of human junctional adhesion molecule 3 (JAM3) and its identification as the JAM2 counter-receptor.Arrate M.P., Rodriguez J.M., Tran T.M., Brock T.A., Cunningham S.A.J. Biol. Chem. 276:45826-45832(2001) Leukocyte-endothelial-cell interactions in leukocyte transmigration and the inflammatory response.Muller W.A.Trends Immunol. 24:327-334(2003) Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D.J. Proteome Res. 4:2070-2080(2005)

393715111

NP_001257336.1

NM_001270407.1

P57087

27.5kD

Cell Adhesion Molecules (CAMs) Pathway (83069); Cell Adhesion Molecules (CAMs) Pathway (480); Cell Surface Interactions At The Vascular Wall Pathway (1269373); Epithelial Cell Signaling In Helicobacter Pylori Infection Pathway (83102); Epithelial Cell Signaling In Helicobacter Pylori Infection Pathway (515); Extracellular Matrix Organization Pathway (1270244); Hemostasis Pathway (1269340); Integrin Cell Surface Interactions Pathway (1270260); Leukocyte Transendothelial Migration Pathway (83083); Leukocyte Transendothelial Migration Pathway (494)

This gene belongs to the immunoglobulin superfamily, and the junctional adhesion molecule (JAM) family. The protein encoded by this gene is a type I membrane protein that is localized at the tight junctions of both epithelial and endothelial cells. It acts as an adhesive ligand for interacting with a variety of immune cell types, and may play a role in lymphocyte homing to secondary lymphoid organs. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2012]

JAM2: May play a role in the processes of lymphocyte homing to secondary lymphoid organs. Belongs to the immunoglobulin superfamily. Protein type: Membrane protein, integral; Cell adhesion. Chromosomal Location of Human Ortholog: 21q21.2. Cellular Component: integral to plasma membrane; plasma membrane; tight junction. Molecular Function: protein binding; protein heterodimerization activity. Biological Process: blood coagulation; cell-cell adhesion; extracellular matrix organization and biogenesis; leukocyte migration; negative regulation of cell adhesion

0.05 mg (E-Coli)

190 USD

0.05 mg (Yeast)

190

0.2 mg (E-Coli)

460

0.2 mg (Yeast)

460

0.5 mg (Yeast)

750