product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Statherin (STATH)
catalog :
MBS965158
quantity :
1 mg (E Coli Derived
price :
1375 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS965158
products type :
Recombinant Protein
products full name :
Recombinant Human Statherin (STATH)
products short name :
Statherin (STATH)
products name syn :
Recombinant Statherin (STATH); Statherin
other names :
statherin isoform b; Statherin; statherin; statherin
products gene name syn :
STATH
other gene names :
STATH; STATH; STR
uniprot entry name :
STAT_HUMAN
host :
E Coli or Yeast
sequence positions :
20-62
sequence length :
62
sequence :
DSSEEKFLRRIGRFGYGYGPYQPVPEQPLYPQPYQPQYQ
QYTF
purity :
>90%
form :
This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Tag Information: GST tagged (Host tag may vary. Please inquire for specific tag information). Species: Homo sapiens (Human)
other info2 :
Storage Buffer: PBS pH 7.4, 50% glycerol
ncbi gi num :
57164946
ncbi acc num :
NP_001009181.1
ncbi gb acc num :
NM_001009181.1
uniprot acc num :
P02808
ncbi mol weight :
7,304 Da
ncbi pathways :
Salivary Secretion Pathway 153376!!Salivary Secretion Pathway 153352
uniprot summary :
Function: Salivary protein that stabilizes saliva supersaturated with calcium salts by inhibiting the precipitation of calcium phosphate salts. It also modulates hydroxyapatite crystal formation on the tooth surface. Subcellular location: Secreted. Tissue specificity: Secreted by parotid and submandibular glands. Post-translational modification: Substrate for transglutaminase-2. More than 95% of the cyclized peptide is cyclo-statherin Q-37, and less than 5% is cyclo-statherin Q-39. Cyclized forms account for about 1% of total statherin in saliva. Sequence similarities: Belongs to the histatin/statherin family. Mass spectrometry: Molecular mass is 5380.0 0.3 Da from positions 20 - 62. Determined by ESI. With phosphorylated Ser-21 and Ser-22. Ref.10Molecular mass is 5363.0 0.3 Da from positions 20 - 62. Determined by ESI. With phosphorylated Ser-21 and Ser-22 and transglutamine cross-link. Ref.10
size :
1 mg (E Coli Derived)
price :
1375 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!