catalog number :
MBS965008
products type :
Recombinant Protein
products full name :
Recombinant Human Band 3 anion transport protein (SLC4A1)
products short name :
Band 3 anion transport protein (SLC4A1)
products name syn :
Recombinant Band 3 anion transport protein (SLC4A1); Band 3 anion transport protein; Anion exchange protein 1; AE 1; Anion exchanger 1 Solute carrier family 4 member 1 CD_antigen= CD233
other names :
band 3 anion transport protein; Band 3 anion transport protein; band 3 anion transport protein; Swann blood group; anion exchanger 1; anion exchanger-1; Froese blood group; Wright blood group; Waldner blood group; anion exchange protein 1; erythroid anion exchange protein; erythrocyte membrane protein band 3; solute carrier family 4, anion exchanger, number 1; solute carrier family 4, anion exchanger, member 1 (erythrocyte membrane protein band 3, Diego blood group); Anion exchange protein 1; AE 1; Anion exchanger 1; Solute carrier family 4 member 1
products gene name syn :
SLC4A1; AE1, DI, EPB3
other gene names :
SLC4A1; SLC4A1; DI; FR; SW; WD; WR; AE1; WD1; BND3; EPB3; CD233; EMPB3; RTA1A; AE1; DI; EPB3; AE 1
uniprot entry name :
B3AT_HUMAN
sequence positions :
1-911
sequence :
MEELQDDYEDMMEENLEQEEYEDPDIPESQMEEPAAHDT
EATATDYHTTSHPGTHKVYVELQELVMDEKNQELRWMEA
ARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKG
TVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRA
LLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSL
ETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGRA
DFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEA
PHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLE
GFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSSP
AKPDSSFYKGLDLNGGPDDPLQQTGQLFGGLVRDIRRRY
PYYLSDITDAFSPQVLAAVIFIYFAALSPAITFGGLLGE
KTRNQMGVSELLISTAVQGILFALLGAQPLLVVGFSGPL
LVFEEAFFSFCETNGLEYIVGRVWIGFWLILLVVLVVAF
EGSFLVRFISRYTQEIFSFLISLIFIYETFSKLIKIFQD
HPLQKTYNYNVLMVPKPQGPLPNTALLSLVLMAGTFFFA
MMLRKFKNSSYFPGKLRRVIGDFGVPISILIMVLVDFFI
QDTYTQKLSVPDGFKVSNSSARGWVIHPLGLRSEFPIWM
MFASALPALLVFILIFLESQITTLIVSKPERKMVKGSGF
HLDLLLVVGMGGVAALFGMPWLSATTVRSVTHANALTVM
GKASTPGAAAQIQEVKEQRISGLLVAVLVGLSILMEPIL
SRIPLAVLFGIFLYMGVTSLSGIQLFDRILLLFKPPKYH
PDVPYVKRVKTWRMHLFTGIQIICLAVLWVVKSTPASLA
LPFVLILTVPLRRVLLPLIFRNVELQCLDADDAKATFDE
EEGRDEYDEVAMPV
form :
This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Tag Information: His tagged (Host tag may vary. Please inquire for specific tag information). Species: Homo sapiens (Human)
other info2 :
Storage Buffer: PBS pH 7.4, 50% glycerol
ncbi acc num :
NP_000333.1
ncbi gb acc num :
NM_000342.3
ncbi mol weight :
101,792 Da
ncbi pathways :
Bicarbonate Transporters Pathway 119560!!Collecting Duct Acid Secretion Pathway 147586!!Collecting Duct Acid Secretion Pathway 147560!!Metabolism Pathway 477135!!O2/CO2 Exchange In Erythrocytes Pathway 645346!!SLC-mediated Transmembrane Transport Pathway 119558!!Transmembrane Transport Of Small Molecules Pathway 106572!!Transport Of Inorganic Cations/anions And Amino Acids/oligopeptides Pathway 119559!!Uptake Of Carbon Dioxide And Release Of Oxygen By Erythrocytes Pathway 645347!!Uptake Of Oxygen And Release Of Carbon Dioxide By Erythrocytes Pathway 645348
ncbi summary :
The protein encoded by this gene is part of the anion exchanger (AE) family and is expressed in the erythrocyte plasma membrane, where it functions as a chloride/bicarbonate exchanger involved in carbon dioxide transport from tissues to lungs. The protein comprises two domains that are structurally and functionally distinct. The N-terminal 40kDa domain is located in the cytoplasm and acts as an attachment site for the red cell skeleton by binding ankyrin. The glycosylated C-terminal membrane-associated domain contains 12-14 membrane spanning segments and carries out the stilbene disulphonate-sensitive exchange transport of anions. The cytoplasmic tail at the extreme C-terminus of the membrane domain binds carbonic anhydrase II. The encoded protein associates with the red cell membrane protein glycophorin A and this association promotes the correct folding and translocation of the exchanger. This protein is predominantly dimeric but forms tetramers in the presence of ankyrin. Many mutations in this gene are known in man, and these mutations can lead to two types of disease: destabilization of red cell membrane leading to hereditary spherocytosis, and defective kidney acid secretion leading to distal renal tubular acidosis. Other mutations that do not give rise to disease result in novel blood group antigens, which form the Diego blood group system. Southeast Asian ovalocytosis (SAO, Melanesian ovalocytosis) results from the heterozygous presence of a deletion in the encoded protein and is common in areas where Plasmodium falciparum malaria is endemic. One null mutation in this gene is known, resulting in very severe anemia and nephrocalcinosis. [provided by RefSeq, Jul 2008]
uniprot summary :
Function: Band 3 is the major integral glycoprotein of the erythrocyte membrane. Band 3 has two functional domains. Its integral domain mediates a 1:1 exchange of inorganic anions across the membrane, whereas its cytoplasmic domain provides binding sites for cytoskeletal proteins, glycolytic enzymes, and hemoglobin. Enzyme regulation: Phenyl isothiocyanate inhibits anion transport in vitro. Subunit structure: A dimer in solution, it spans the membrane asymmetrically and appears to be tetrameric. Interacts (via cytoplasmic N-terminus domain) with ANK1 (via N-terminus ANK repeats). Ref.17. Subcellular location: Membrane; Multi-pass membrane protein. Tissue specificity: Erythrocytes. Post-translational modification: Phosphorylated on Tyr-8 and Tyr-21 most likely by SYK. PP1-resistant phosphorylation that precedes Tyr-359 and Tyr-904 phosphorylation. Ref.15 Ref.18Phosphorylated on Tyr-359 and Tyr-904 most likely by LYN. PP1-inhibited phosphorylation that follows Tyr-8 and Tyr-21 phosphorylation. Ref.15 Ref.18. Polymorphism: SLC4A1 is responsible for the Diego blood group system. The molecular basis of the Di(a)=Di1/Di(b)/Di2 blood group antigens is a single variation in position 854; Leu-854 corresponds to Di(a) and Pro-854 to Di(b). The molecular basis of the Wr(a)=Di3/Wr(b)/Di4 blood group antigens is a single variation in position 658; Lys-658 corresponds to Wr(a) and Glu-658 to Wr(b). The blood group antigens Wd(a)=Di5 (Waldner-type) has Met-557; Rb(a)=Di6 has Leu-548 and WARR=Di7 has Ile-552.SLC4A1 is responsible for the Swann blood group system (SW) [. MIM:601550]. Sw(a+) has a Gln or a Trp at position 646 and Sw(a-) has an Arg.SLC4A1 is responsible for the Froese blood group system (FR) [. MIM:601551]. FR(a+) has a Lys at position 480 and FR(a-) has a Glu.Genetic variations in SLC4A1 are involved in resistance to malaria [. MIM:611162]. Involvement in disease: Defects in SLC4A1 are the cause of elliptocytosis type 4 (EL4) [. MIM:109270]. EL4 is a Rhesus-unlinked form of hereditary elliptocytosis, a genetically heterogeneous, autosomal dominant hematologic disorder. It is characterized by variable hemolytic anemia and elliptical or oval red cell shape. Ref.29 Ref.31Defects in SLC4A1 are the cause of spherocytosis type 4 (SPH4) [. MIM:612653]; also known as hereditary spherocytosis type 4 (HS4). Spherocytosis is a hematologic disorder leading to chronic hemolytic anemia and characterized by numerous abnormally shaped erythrocytes which are generally spheroidal. Ref.13 Ref.30 Ref.36 Ref.37 Ref.38 Ref.39 Ref.40 Ref.41 Ref.45 Ref.50 Ref.52 Ref.53 Ref.58 Ref.61 Ref.62Defects in SLC4A1 are the cause of renal tubular acidosis, distal, autosomal dominant (AD-dRTA) [. MIM:179800]. A disease characterized by reduced ability to acidify urine, variable hyperchloremic hypokalemic metabolic acidosis, nephrocalcinosis, and nephrolithiasis.Defects in SLC4A1 are the cause of renal tubular acidosis, distal, with hemolytic anemia (dRTA-HA) [. MIM:611590]. A disease characterized by the association of hemolytic anemia with distal renal tubular acidosis, the reduced ability to acidify urine resulting in variable hyperchloremic hypokalemic metabolic acidosis, nephrocalcinosis, and nephrolithiasis.Defects in SLC4A1 are the cause of renal tubular acidosis, distal, with normal red cell morphology (dRTA-NRC) [. MIM:611590]. A disease characterized by reduced ability to acidify urine, variable hyperchloremic hypokalemic metabolic acidosis, nephrocalcinosis, and nephrolithiasis. Sequence similarities: Belongs to the anion exchanger (TC 2.A.31) family. [View classification]
size :
1 mg (E Coli Derived)