Recombinant Mouse Plasma protease C1 inhibitor | MyBioSource MBS964902 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Mouse Plasma protease C1 inhibitor

catalog :

MBS964902

quantity :

0.05 mg (E-Coli)

price :

185 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS964902

products type :

Recombinant Protein

products full name :

Recombinant Mouse Plasma protease C1 inhibitor

products short name :

Plasma protease C1 inhibitor

products name syn :

C1 esterase inhibitor; C1-inhibiting factor; Serpin G1

other names :

plasma protease C1 inhibitor; Plasma protease C1 inhibitor; plasma protease C1 inhibitor; serine (or cysteine) peptidase inhibitor, clade G, member 1; C1 esterase inhibitor; C1-inhibiting factor; Serpin G1

products gene name :

SERPING1

products gene name syn :

C1IN; C1NH

other gene names :

Serping1; Serping1; C1nh; C1INH; C1nh; C1 Inh; C1Inh

uniprot entry name :

IC1_MOUSE

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

31-503

sequence length :

504

sequence :

TQDPLEAQAKSRESFPERDDSWSPPEPTVLPSTWPTTSV
AITITNDTMGKVANESFSQHSQPAAQLPTDSPGQPPLNS
SSQPSTASDLPTQATTEPFCPEPLAQCSDSDRDSSEAKL
SEALTDFSVKLYHAFSATKMAKTNMAFSPFSIASLLTQV
LLGAGDSTKSNLESILSYPKDFACVHQALKGFSSKGVTS
VSQIFHSPDLAIRDTYVNASQSLYGSSPRVLGPDSAANL
ELINTWVAENTNHKIRKLLDS

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products description :

Activation of the C1 complex is under control of the C1-inhibitor. It forms a proteolytically inactive stoichiometric complex with the C1r or C1s proteases. May play a potentially crucial role in regulating important physiological pathways including complent activation, blood coagulation, fibrinolysis and the generation of kinins. Very efficient inhibitor of FXIIa. May inhibit chymotrypsin and kallikrein.

products references :

The sequence of a cDNA encoding functional murine C1-inhibitor protein.Russell J.A., Whaley K., Heaphy S.Biochim. Biophys. Acta 1352:156-160(1997) Molecular cloning, gene structure and expression profile of mouse C1 inhibitor.Lener M., Vinci G., Duponchel C., Meo T., Tosi M.Eur. J. Biochem. 254:117-122(1998) Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) Proteome-wide characterization of N-glycosylation events by diagonal chromatography.Ghesquiere B., Van Damme J., Martens L., Vandekerckhove J., Gevaert K.J. Proteome Res. 5:2438-2447(2006) Enhanced analysis of the mouse plasma proteome using cysteine-containing tryptic glycopeptides.Bernhard O.K., Kapp E.A., Simpson R.J.J. Proteome Res. 6:987-995(2007)

ncbi gi num :

163914390

ncbi acc num :

NP_033906.2

ncbi gb acc num :

NM_009776.3

uniprot acc num :

P97290

ncbi mol weight :

56.4kD

ncbi pathways :

Complement And Coagulation Cascades Pathway (198335); Complement And Coagulation Cascades Pathway (83270); Complement And Coagulation Cascades Pathway (484); Formation Of Fibrin Clot (Clotting Cascade) Pathway (1323587); Hemostasis Pathway (1323559); Intrinsic Pathway Of Fibrin Clot Formation (1323589); Pertussis Pathway (218112); Pertussis Pathway (218099); Platelet Activation, Signaling And Aggregation Pathway (1323569); Platelet Degranulation Pathway (1323586)

uniprot summary :

SERPING1: a protein protease inhibitor (C1-inhibitor) that forms a proteolytically inactive stoichiometric complex with the C1r or C1s proteases. May play an important role in regulating complement activation, blood coagulation, fibrinolysis and the generation of kinins. Very efficient inhibitor of FXIIa. Mutations of the SERPING1 gene is associated with adult macular degeneration can also cause hereditary angioedema. Binds to E.coli stcE which allows localization of SERPING1 to cell membranes thus protecting the bacteria against complement-mediated lysis. Belongs to the serpin family. Protein type: Secreted, signal peptide; Secreted. Cellular Component: extracellular region; extracellular space. Molecular Function: complement binding; protease inhibitor activity; serine-type endopeptidase inhibitor activity. Biological Process: blood coagulation; complement activation, classical pathway; fibrinolysis; hemostasis; immune system process; innate immune response; negative regulation of complement activation, lectin pathway; negative regulation of peptidase activity

size1 :

0.05 mg (E-Coli)

price1 :

185 USD

size2 :

0.2 mg (E-Coli)

price2 :

420

size3 :

0.5 mg (E-Coli)

price3 :

680

size4 :

1 mg (E-Coli)

price4 :

1070

more info or order :

MyBioSource product webpage