protein

Recombinant Human Sex hormone-binding globulin

MBS964742

0.2 mg

460 USD

Recombinant Protein

Recombinant Human Sex hormone-binding globulin

[Sex hormone-binding globulin]

[Sex steroid-binding protein; SBP; Testis-specific androgen-binding protein; ABP; Testosterone-estradiol-binding globulin; TeBG; Testosterone-estrogen-binding globulin]

[sex hormone-binding globulin isoform 1; Sex hormone-binding globulin; sex hormone-binding globulin; sex hormone-binding globulin; Sex steroid-binding protein; SBP; Testis-specific androgen-binding protein; ABP; Testosterone-estradiol-binding globulin; TeBG; Testosterone-estrogen-binding globulin]

[SHBG]

[SHBG; SHBG; ABP; SBP; TEBG; SHBG; SBP; ABP; TeBG]

SHBG_HUMAN

E. coli

[30-402]

LRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITK
TSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEI
QLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVD
GEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLP
LVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPG
IFLPPGTQAEFNLRDIPQPHAEPWAFSLDLGLKQAAGSG
HLLALGTPENPSWLSLHLQDQKVVLSSGSGPGLDLPLVL
GLPLQLKLSMSRVVLSQGSKMKALALPPLGLAPLLNLWA
KPQGRLFLGALPGEDSSTSFCLNGLWAQGQRLDVDQALN
RSHEIWTHSCPQSPGNGTDASH

85% 5% by SDS-PAGE

Liquid, dissolved in 20mM Tris-HCl, 500mM NaCl, pH 8.0, 50% glycerol

Aliquot and store at -20°C. Avoid repeated freeze / thaw cycles

Calibrator or standard

Tag Info: his-tag

Valid Period: -20°C for one year

Signal Transduction

Characterization of the human sex hormone binding globulin (SHBG) gene and demonstration of two transcripts in both liver and testis.Gershagen S., Lundwall A., Fernlund P.Nucleic Acids Res. 17:9245-9258(1989) The human sex hormone-binding globulin gene contains exons for androgen-binding protein and two other testicular messenger RNAs.Hammond G.L., Underhill D.A., Rykse H.M., Smith C.L.Mol. Endocrinol. 3:1869-1876(1989) PCR isolation and cloning of novel splice variant mRNAs from known drug target genes.Jin P., Fu G.K., Wilson A.D., Yang J., Chien D., Hawkins P.R., Au-Young J., Stuve L.L.Genomics 83:566-571(2004) DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L., Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.Nature 440:1045-1049(2006) The cDNA-deduced primary structure of human sex hormone-binding globulin and location of its steroid-binding domain.Hammond G.L., Underhill D.A., Smith C.L., Goping I.S., Harley M.J., Musto N.A., Cheng C.Y., Bardin C.W.FEBS Lett. 215:100-104(1987) Human sex hormone-binding globulin gene transcript expression in liver, prostate, breast, testis, and brain- multiple promoters and complex alternative splicing.Kahn S.M., Nakhla A.M., Hryb D.J., Rosner W., Romas N.A. A cDNA coding for human sex hormone binding globulin. Homology to vitamin K-dependent protein S.Gershagen S., Fernlund P., Lundwall A.FEBS Lett. 220:129-135(1987) Characterization of a cDNA coding for sex steroid-binding protein of human plasma.Que B.G., Petra P.H.FEBS Lett. 219:405-409(1987) Physicochemical characteristics of human sex hormone binding globulin evidence for two identical subunits.Hammond G.L., Robinson P.A., Sugino H., Ward D.N., Finne J.J. Steroid Biochem. 24:815-824(1986) Amino acid sequence of the sex steroid binding protein of human blood plasma.Walsh K.A., Titani K., Takio K., Kumar S., Hayes R., Petra P.H.Biochemistry 25:7584-7590(1986) Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D.J. Proteome Res. 4:2070-2080(2005) Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.J. Proteome Res. 8:651-661(2009) Molecular analyses of a human sex hormone-binding globulin variant evidence for an additional carbohydrate chain.Power S.G.A., Bocchinfuso W.P., Pallesen M., Warmels-Rodenhiser S., Van Baelen H., Hammond G.L.J. Clin. Endocrinol. Metab. 75:1066-1070(1992) Crystal structure of human sex hormone-binding globulin steroid transport by a laminin G-like domain.Grishkovskaya I., Avvakumov G.V., Sklenar G., Dales D., Hammond G.L., Muller Y.A.EMBO J. 19:504-512(2000) Steroid ligands bind human sex hormone-binding globulin in specific orientations and produce distinct changes in protein conformation.Grishkovskaya I., Avvakumov G.V., Hammond G.L., Catalano M.G., Muller Y.A.J. Biol. Chem. 277:32086-32093(2002) Molecular characterization of a genetic variant of the steroid hormone-binding globulin gene in heterozygous subjects.Hardy D.O., Carino C., Catterall J.F., Larrea F.J. Clin. Endocrinol. Metab. 80:1253-1256(1995) Characterization of single-nucleotide polymorphisms in coding regions of human genes.Cargill M., Altshuler D., Ireland J., Sklar P., Ardlie K., Patil N., Shaw N., Lane C.R., Lim E.P., Kalyanaraman N., Nemesh J., Ziaugra L., Friedland L., Rolfe A., Warrington J., Lipshutz R., Daley G.Q., Lander E.S.Nat. Genet. 22:231-238(1999) ErratumCargill M., Altshuler D., Ireland J., Sklar P., Ardlie K., Patil N., Shaw N., Lane C.R., Lim E.P., Kalyanaraman N., Nemesh J., Ziaugra L., Friedland L., Rolfe A., Warrington J., Lipshutz R., Daley G.Q., Lander E.S.Nat. Genet. 23:373-373(1999)

7382460

NP_001031.2

NM_001040.4

P04278

This gene encodes a steroid binding protein that was first described as a plasma protein secreted by the liver but is now thought to participate in the regulation of steroid responses. The encoded protein transports androgens and estrogens in the blood, binding each steroid molecule as a dimer formed from identical or nearly identical monomers. Polymorphisms in this gene have been associated with polycystic ovary syndrome and type 2 diabetes mellitus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]

SHBG: Functions as an androgen transport protein, but may also be involved in receptor mediated processes. Each dimer binds one molecule of steroid. Specific for 5-alpha-dihydrotestosterone, testosterone, and 17-beta-estradiol. Regulates the plasma metabolic clearance rate of steroid hormones by controlling their plasma concentration. 2 isoforms of the human protein are produced by alternative splicing. Protein type: Secreted; Secreted, signal peptide. Chromosomal Location of Human Ortholog: 17p13.1. Cellular Component: extracellular region. Molecular Function: androgen binding

0.2 mg

460 USD

0.5 mg

750

1 mg

1180