Recombinant Human ATP-sensitive inward rectifier potassium channel 1 (KCNJ1) | MyBioSource MBS964715 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human ATP-sensitive inward rectifier potassium channel 1 (KCNJ1)

catalog :

MBS964715

quantity :

INQUIRE

price :

INQUIRE

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS964715

products type :

Recombinant Protein

products full name :

Recombinant Human ATP-sensitive inward rectifier potassium channel 1 (KCNJ1)

products short name :

ATP-sensitive inward rectifier potassium channel 1 (KCNJ1)

products name syn :

Recombinant ATP-sensitive inward rectifier potassium channel 1 (KCNJ1); ATP-sensitive inward rectifier potassium channel 1; ATP-regulated potassium channel ROM-K Inward rectifier K(+) channel Kir1.1 Potassium channel, inwardly rectifying subfamily J membe

other names :

ATP-sensitive inward rectifier potassium channel 1 isoform a; ATP-sensitive inward rectifier potassium channel 1; ATP-sensitive inward rectifier potassium channel 1; inwardly rectifying K+ channel; inward rectifier K(+) channel Kir1.1; ATP-regulated potassium channel ROM-K; potassium channel, inwardly rectifying subfamily J member 1; potassium inwardly-rectifying channel, subfamily J, member 1; ATP-regulated potassium channel ROM-K; Inward rectifier K(+) channel Kir1.1; Potassium channel, inwardly rectifying subfamily J member 1

products gene name syn :

KCNJ1; ROMK1

other gene names :

KCNJ1; KCNJ1; ROMK; ROMK1; KIR1.1; ROMK1

uniprot entry name :

IRK1_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

178-391

sequence length :

391

sequence :

LDQININFVVDAGNENLFFISPLTIYHVIDHNSPFFHMAAETLLQQDFELVVFLDGTVESTSAT CQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLYNEKDVRA RMKRGYDNPNFILSEVNETDDTKM
ILAKISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANL
RKSLLIGSHIYGKLLKTTVTPEGETII

purity :

>90% (SDS-PAGE)

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

other info1 :

Species: Homo sapiens (Human)

products description :

In the kidney, probably plays a major role in potassium homeostasis. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. This channel is activated by internal ATP and can be blocked by external barium.

ncbi gi num :

4504837

ncbi acc num :

NP_000211.1

ncbi gb acc num :

NM_000220.4

uniprot acc num :

P48048

ncbi mol weight :

25 kDa

ncbi pathways :

Aldosterone-regulated Sodium Reabsorption Pathway (130626); Aldosterone-regulated Sodium Reabsorption Pathway (130590); Gastric Acid Secretion Pathway (154409); Gastric Acid Secretion Pathway (154383); Inwardly Rectifying K+ Channels Pathway (366224); Neuronal System Pathway (106513); Potassium Channels Pathway (366221); Potassium Transport Channels Pathway (366227)

ncbi summary :

Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. It is activated by internal ATP and probably plays an important role in potassium homeostasis. The encoded protein has a greater tendency to allow potassium to flow into a cell rather than out of a cell. Mutations in this gene have been associated with antenatal Bartter syndrome, which is characterized by salt wasting, hypokalemic alkalosis, hypercalciuria, and low blood pressure. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

uniprot summary :

ROMK: an inward rectifier-type potassium channel protein. Probably plays a major role in potassium homeostasis in the kidney. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. The channel is activated by internal ATP and can be blocked by external barium. High levels of expression in the kidney and pancreatic islets. Lower levels in skeletal muscle, pancreas, spleen, brain, heart and liver. Three alternatively spliced isoforms have been described. Protein type: Membrane protein, multi-pass; Channel, potassium; Membrane protein, integral. Chromosomal Location of Human Ortholog: 11q24. Cellular Component: voltage-gated potassium channel complex; plasma membrane. Molecular Function: phosphatidylinositol-4,5-bisphosphate binding; ATP-activated inward rectifier potassium channel activity; inward rectifier potassium channel activity; ATP binding. Biological Process: synaptic transmission; potassium ion import; tissue homeostasis; kidney development; excretion; potassium ion transport; post-embryonic development. Disease: Bartter Syndrome, Antenatal, Type 2

size1 :

INQUIRE

price1 :

INQUIRE

more info or order :

MyBioSource product webpage