catalog number :
MBS964636
products type :
Recombinant Protein
products full name :
Recombinant Human Matrix Gla protein
products short name :
Matrix Gla protein
products name syn :
Cell growth-inhibiting gene 36 protein
other names :
matrix Gla protein isoform 2; Matrix Gla protein; matrix Gla protein; matrix Gla protein; Cell growth-inhibiting gene 36 protein
products gene name syn :
Mglap
other gene names :
MGP; MGP; NTI; GIG36; MGLAP; MGLAP; MGP
uniprot entry name :
MGP_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
20-96
sequence :
YESHESMESYELNPFINRRNANTFISPQQRWRAKVQERI
RERSKPVHELNREACDDYRLCERYAMVYGYNAAYNRYF
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
other info2 :
20-96; Mature full length protein
products categories :
Developmental Biology
products description :
Associates with the organic matrix of bone and cartilage. Thought to act as an inhibitor of bone formation.
products references :
Molecular structure, chromosome assignment, and promoter organization of the human matrix Gla protein gene.Cancela M.L., Hsieh C.-L., Francke U., Price P.A.J. Biol. Chem. 265:15040-15048(1990)
ncbi acc num :
NP_000891.2
ncbi gb acc num :
NM_000900.3
ncbi pathways :
Endochondral Ossification Pathway (198812); Validated Transcriptional Targets Of AP1 Family Members Fra1 And Fra2 Pathway (169349)
ncbi summary :
The protein encoded by this gene is secreted and likely acts as an inhibitor of bone formation. The encoded protein is found in the organic matrix of bone and cartilage. Defects in this gene are a cause of Keutel syndrome (KS). Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]
uniprot summary :
MGP: Associates with the organic matrix of bone and cartilage. Thought to act as an inhibitor of bone formation. Defects in MGP are the cause of Keutel syndrome (KS). KS is an autosomal recessive disorder characterized by abnormal cartilage calcification, peripheral pulmonary stenosis neural hearing loss and midfacial hypoplasia. Belongs to the osteocalcin/matrix Gla protein family. Protein type: Secreted, signal peptide; Extracellular matrix; Secreted. Chromosomal Location of Human Ortholog: 12p12.3. Cellular Component: extracellular matrix; proteinaceous extracellular matrix. Molecular Function: calcium ion binding; extracellular matrix structural constituent; protein binding; structural constituent of bone. Biological Process: cartilage condensation; cell differentiation; ossification; regulation of bone mineralization. Disease: Keutel Syndrome
size4 :
0.05 mg (Baculovirus)
size5 :
0.05 mg (Mammalian-Cell)