catalog number :
MBS964554
products type :
Recombinant Protein
products full name :
Recombinant Mouse Oncomodulin
products short name :
Oncomodulin
products name syn :
Parvalbumin beta
other names :
oncomodulin; Oncomodulin; oncomodulin; oncomodulin; Parvalbumin beta
other gene names :
Ocm; Ocm; OM
uniprot entry name :
ONCO_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
2-109
sequence :
SITDILSADDIAAALQECQDPDTFEPQKFFQTSGLSKMS
ASQLKDIFQFIDNDQSGYLDEDELKYFLQRFQSDARELT
ESETKSLMDAADNDGDGKIGADEFQEMVHS
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
other info2 :
Species: Mus musculus (Mouse)
products categories :
Neuroscience
products description :
Has some calmodulin-like activity with respect to enzyme activation and growth regulation. Binds two calcium ions.
products references :
The intracisternal A particle derived solo LTR promoter of the rat oncomodulin gene is not present in the mouse gene."
Banville D., Rotaru M., Boie Y.
Genetica 86:85-97(1992)
ncbi acc num :
NP_149028.2
ncbi gb acc num :
NM_033039.3
ncbi mol weight :
28.12kd
uniprot summary :
OCM2: This gene is similar to the oncomodulin gene, a high-affinity calcium ion-binding protein that belongs to the superfamily of calmodulin proteins, also known as the EF-hand proteins. [provided by RefSeq, Jul 2008]. Cellular Component: cell; cytoplasm; cytosol; nucleus; protein complex. Molecular Function: calcium ion binding; metal ion binding; protein heterodimerization activity; protein homodimerization activity. Biological Process: cytosolic calcium ion homeostasis