catalog number :
MBS964528
products type :
Recombinant Protein
products full name :
Recombinant Mouse Microtubule-associated protein tau
products short name :
Microtubule-associated protein tau
products name syn :
Neurofibrillary tangle protein; Paired helical filament-tau; PHF-tau
other names :
microtubule-associated protein tau isoform a; Microtubule-associated protein tau; microtubule-associated protein tau; microtubule-associated protein tau; Neurofibrillary tangle protein; Paired helical filament-tau; PHF-tau
products gene name :
Mapt
other gene names :
Mapt; Mapt; Tau; Mtapt; AI413597; AW045860; Mtapt; Tau; PHF-tau
uniprot entry name :
TAU_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
2-733, Full length
sequence :
ADPRQEFDTMEDHAGDYTLLQDQEGDMDHGLKESPPQPP
ADDGAEEPGSETSDAKSTPTAEDVTAPLVDERAPDKQAA
AQPHTEIPEGITAEEAGIGDTPNQEDQAAGHVTQGRREG
QAPDLGTSDWTRQQVSSMSGAPLLPQGLREATCQPSGTR
PEDIEKSHPASELLRRGPPQKEGWGQDRLGSEEEVDEDL
TVDESSQDSPPSQASLTPGRAAPQAGSGSVCGETASVPG
LPTEGSVPLPADFFSKVSAETQASQPEGPGTGPMEEGHE
AAPEFTFHVEIKASTPKEQDLEGATVVGVPGEEQKAQTQ
GPSVGKGTKEASLQEPPGKQPAAGLPGRPVSRVPQLKAR
VASKDRTGNDEKKAKTSTPSCAKAPSHRPCLSPTRPTLG
SSDPLIKPSSPAVSPEPATSPKHVSSVTPRNGSPGTKQM
KLKGADGKTGAKIATPRGAASPAQKGTSNATRIPAKTTP
SPKTPPGSGEPPKSGERSGYSSPGSPGTPGSRSRTPSLP
TPPTREPKKVAVVRTPPKSPSASKSRLQTAPVPMPDLKN
VRSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSK
DNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPG
GGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIE
THKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNV
SSTGSIDMVDSPQLATLADEVSASLAKQGL
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
other info2 :
Species: Mus musculus (Mouse)
products categories :
Neuroscience
products description :
Promotes microtubule assembly and stability, and might be involved in the establishment and maintenance of neuronal polarity. The C-terminus binds axonal microtubules while the N-terminus binds neural plasma membrane components, suggesting that tau functions as a linker protein between both. Axonal polarity is predetermined by tau localization (in the neuronal cell) in the domain of the cell body defined by the centrosome. The short isoforms allow plasticity of the cytoskeleton whereas the longer isoforms may preferentially play a role in its stabilization.
products references :
Expression of three- and four-repeat tau isoforms in mouse liver."
Kenner L., el-Shabrawi Y., Hutter H., Forstner M., Zatloukal K., Hoefler G., Preisegger K.-H., Kurzbauer R., Denk H.
Hepatology 20:1086-1089(1994)
ncbi acc num :
NP_001033698.1
ncbi gb acc num :
NM_001038609.2
ncbi mol weight :
78.11kD
ncbi pathways :
Alzheimer's Disease Pathway (83294); Alzheimer's Disease Pathway (509); Apoptosis Pathway (1323524); Apoptotic Cleavage Of Cellular Proteins Pathway (1323549); Apoptotic Execution Phase Pathway (1323548); Caspase-mediated Cleavage Of Cytoskeletal Proteins Pathway (1323550); IL-6 Signaling Pathway (198302); MAPK Signaling Pathway (198294); MAPK Signaling Pathway (83245); MAPK Signaling Pathway (456)
uniprot summary :
Tau: a microtubule-associated protein that regulates microtubule assembly and stability. Apparently involved in the establishment and maintenance of neuronal polarity. Mutations can result in several neurodegenerative disorders such as Alzheimer's disease, Pick's disease, frontotemporal dementia, cortico-basal degeneration and progressive supranuclear palsy. The C-terminus binds axonal microtubules while the N-terminus binds neural plasma membrane components, suggesting that tau functions as a linker. Axonal polarity is predetermined by tau localization (in the neuronal cell) in the domain of the cell body defined by the centrosome. Nine differentially spliced isoforms have been described. The short isoforms allow plasticity of the cytoskeleton, whereas the longer isoforms may preferentially play a role in its stabilization. Protein type: Cytoskeletal. Cellular Component: axon; axoneme; cell projection; cytoplasm; cytoskeleton; dendrite; growth cone; membrane; microtubule; microtubule associated complex; microtubule cytoskeleton; neuron projection; nucleus; plasma membrane; postsynaptic density; tubulin complex. Molecular Function: apolipoprotein binding; enzyme binding; Hsp90 protein binding; microtubule binding; protein binding; protein complex binding; protein domain specific binding; protein kinase binding; protein phosphatase 2A binding; SH3 domain binding; tubulin binding. Biological Process: adult walking behavior; apoptosis; axon cargo transport; axon extension; axonogenesis; induction of apoptosis by oxidative stress; microtubule cytoskeleton organization and biogenesis; mitochondrion transport along microtubule; negative regulation of intracellular transport; neuron migration; positive regulation of axon extension; positive regulation of microtubule polymerization; regulation of autophagy; response to nutrient; response to organic substance