product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse Complement receptor type 2
catalog :
MBS964515
quantity :
0.01 mg (Yeast)
price :
110 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS964515
products type :
Recombinant Protein
products full name :
Recombinant Mouse Complement receptor type 2
products short name :
Complement receptor type 2
products name syn :
Complement C3d receptor; CD_antigen: CD21
other names :
Complement receptor type 2; Complement receptor type 2; complement receptor type 2; complement receptor 2; Complement C3d receptor; CD_antigen: CD21
products gene name :
Cr2
other gene names :
Cr2; Cr2; Cr1; C3DR; CD21; CD35; Cr-1; Cr-2; Cr2
uniprot entry name :
CR2_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
729-963
sequence length :
1025
sequence :
LYGNEVSYECDEGFYLLGEKSLQCVNDSKGHGSWSGPPP
QCLQSSPLTHCPDPEVKHGYKLNKTHSAFSHNDIVHFVC
NQGFIMNGSHLIRCHTNNTWLPGVPTCIRKASLGCQSPS
TIPNGNHTGGSIARFPPGMSVMYSCYQGFLMAGEARLIC
THEGTWSQPPPFCKEVNCSFPEDTNGIQKGFQPGKTYRF
GATVTLECEDGYTLEGSPQSQCQDDSQWNPPLALCKYRR
W
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
other info2 :
Species: Mus musculus (Mouse)
products categories :
Immunology
products description :
Receptor for complement C3d. Participates in B lymphocytes activation.
products references :
Comparative structure and evolution of murine CR2. The homolog of the human C3d/EBV receptor (CD21)." Fingeroth J.D. J. Immunol. 144:3458-3467(1990)
ncbi gi num :
117316
ncbi acc num :
P19070.1
uniprot acc num :
P19070
ncbi mol weight :
30.07kD
ncbi pathways :
B Cell Receptor Signaling Pathway (198285); B Cell Receptor Signaling Pathway (83278); B Cell Receptor Signaling Pathway (492); Complement And Coagulation Cascades Pathway (198335); Complement And Coagulation Cascades Pathway (83270); Complement And Coagulation Cascades Pathway (484); Epstein-Barr Virus Infection Pathway (585576); Epstein-Barr Virus Infection Pathway (587115); Hematopoietic Cell Lineage Pathway (83275); Hematopoietic Cell Lineage Pathway (489)
uniprot summary :
CR2: Receptor for complement C3Dd, for the Epstein-Barr virus on human B-cells and T-cells and for HNRPU. Participates in B lymphocytes activation. Genetic variations in CR2 are associated with susceptibility to systemic lupus erythematosus type 9 (SLEB9). Systemic lupus erythematosus (SLE) is a chronic autoimmune disease with a complex genetic basis. SLE is an inflammatory, and often febrile multisystemic disorder of connective tissue characterized principally by involvement of the skin, joints, kidneys, and serosal membranes. It is thought to represent a failure of the regulatory mechanisms of the autoimmune system. Defects in CR2 are the cause of immunodeficiency, common variable, type 7 (CVID7). A primary immunodeficiency characterized by antibody deficiency, hypogammaglobulinemia, recurrent bacterial infections and an inability to mount an antibody response to antigen. The defect results from a failure of B-cell differentiation and impaired secretion of immunoglobulins; the numbers of circulating B cells is usually in the normal range, but can be low. Belongs to the receptors of complement activation (RCA) family. 4 isoforms of the human protein are produced by alternative splicing. Protein type: Membrane protein, integral; Receptor, misc. Cellular Component: external side of plasma membrane; integral to membrane; membrane; receptor complex. Molecular Function: complement binding; complement receptor activity; DNA binding; protein binding; protein homodimerization activity; receptor activity. Biological Process: B cell activation; B cell differentiation; B cell proliferation; complement activation, classical pathway; immune system process; innate immune response
size1 :
0.01 mg (Yeast)
price1 :
110 USD
size2 :
0.01 mg (E-Coli)
price2 :
110
size3 :
0.05 mg (Yeast)
price3 :
190
size4 :
0.05 mg (E-Coli)
price4 :
190
size5 :
0.02 mg (Mammalian-Cell)
price5 :
295
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!