protein

Recombinant Human Vitamin D-binding protein

MBS964406

0.05 mg (Yeast)

190 USD

Recombinant Protein

Recombinant Human Vitamin D-binding protein

Vitamin D-binding protein

Gc-globulin; Group-specific component

vitamin D-binding protein isoform 1; Vitamin D-binding protein; vitamin D-binding protein; group-specific component (vitamin D binding protein); Gc protein-derived macrophage activating factor

GC

GC; GC; DBP; GRD3; VDBG; VDBP; GcMAF; DBP/GC; Gc-MAF; HEL-S-51; DBP-maf

VTDB_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

19-474, Partial

474

LERGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSG
TFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAK
SCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEF
PTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPL
SLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSL
LTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLED
VLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNL
STKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVEL
PTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEP
TLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQEL
CADYSENTFTEYKKKLAERLKAKLPDATPKELAKLVNKR
SDFASNCCSINSPPLYCDSEIDAELKNIL

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Transport

Multifunctional protein found in plasma, ascitic fluid, cerebrospinal fluid, and urine and on the surface of many cell types. In plasma, it carries the vitamin D sterols and prevents polymerization of actin by binding its monomers. DBP associates with membrane-bound immunoglobulin on the surface of B-lymphocytes and with IgG Fc receptor on the membranes of T-lymphocytes.

Serum vitamin D-binding protein is a third member of the albumin and alpha fetoprotein gene family.Cooke N.E., David E.V.J. Clin. Invest. 76:2420-2424(1985) Human group-specific component (Gc) is a member of the albumin family.Yang F., Brune J.L., Naylor S.L., Cupples R.L., Naberhaus K.H., Bowman B.H.Proc. Natl. Acad. Sci. U.S.A. 82:7994-7998(1985) Sequence and organization of the human vitamin D-binding protein gene.Braun A., Kofler A., Morawietz S., Cleve H.Biochim. Biophys. Acta 1216:385-394(1993) Complete structure of the human Gc gene differences and similarities between members of the albumin gene family.Witke W.F., Gibbs P.E., Zielinski R., Yang F., Bowman B.H., Dugaiczyk A.Genomics 16:751-754(1993) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. Generation and annotation of the DNA sequences of human chromosomes 2 and 4.Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.Nature 434:724-731(2005)

32483410

NP_000574.2

NM_000583.3

P02774

52.1kD

Metabolism Pathway (1269956); Metabolism Of Fat-soluble Vitamins Pathway (1339147); Metabolism Of Vitamins And Cofactors Pathway (1270144); Vitamin D (calciferol) Metabolism Pathway (1270052); Vitamin D Synthesis Pathway (198764)

The protein encoded by this gene belongs to the albumin gene family. It is a multifunctional protein found in plasma, ascitic fluid, cerebrospinal fluid and on the surface of many cell types. It binds to vitamin D and its plasma metabolites and transports them to target tissues. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Feb 2011]

GC: Multifunctional protein found in plasma, ascitic fluid, cerebrospinal fluid, and urine and on the surface of many cell types. In plasma, it carries the vitamin D sterols and prevents polymerization of actin by binding its monomers. DBP associates with membrane-bound immunoglobulin on the surface of B-lymphocytes and with IgG Fc receptor on the membranes of T-lymphocytes. Belongs to the ALB/AFP/VDB family. 2 isoforms of the human protein are produced by alternative splicing. Protein type: Secreted; Secreted, signal peptide. Chromosomal Location of Human Ortholog: 4q12-q13. Cellular Component: axon; cytosol; extracellular region; extracellular space; lysosomal lumen; perinuclear region of cytoplasm. Molecular Function: actin binding; vitamin D binding; vitamin transporter activity. Biological Process: fat-soluble vitamin metabolic process; female pregnancy; lactation; response to estradiol stimulus; response to nutrient levels; vitamin D metabolic process; vitamin metabolic process; vitamin transport. Disease: Graves Disease, Susceptibility To, 1

0.05 mg (Yeast)

190 USD

0.05 mg (E-Coli)

190

0.2 mg (E-Coli)

460

0.2 mg (Yeast)

460

0.5 mg (Yeast)

750